BLASTX nr result
ID: Paeonia23_contig00032892
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00032892 (198 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD31869.1| hypothetical protein CERSUDRAFT_162701, partial [... 59 7e-07 >gb|EMD31869.1| hypothetical protein CERSUDRAFT_162701, partial [Ceriporiopsis subvermispora B] Length = 87 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/46 (60%), Positives = 31/46 (67%) Frame = +1 Query: 43 RGRTPAMKAC*VPRSQPAYHRGL*HTQTGATFPQTLSAGRNRCWPV 180 RGRTP +KAC PRSQP+Y +T GATFP S RNRCWPV Sbjct: 25 RGRTPTIKACCEPRSQPSYATEGYNTPEGATFPLPFSDDRNRCWPV 70