BLASTX nr result
ID: Paeonia23_contig00032890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00032890 (288 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007208331.1| hypothetical protein PRUPE_ppa002385mg [Prun... 57 2e-06 >ref|XP_007208331.1| hypothetical protein PRUPE_ppa002385mg [Prunus persica] gi|462403973|gb|EMJ09530.1| hypothetical protein PRUPE_ppa002385mg [Prunus persica] Length = 678 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/66 (43%), Positives = 40/66 (60%), Gaps = 2/66 (3%) Frame = -2 Query: 194 MYTIVLIANSTMKTSFRFLYSCRNSAFSGFAPGKCHNTLINSS--SDFCLNLNSSRFFHT 21 M ++ L+ + TMK + R L SCRNSA GF P KC++ L + S+FC+N FHT Sbjct: 1 MNSLSLLCHWTMKPTCRILTSCRNSALFGFPPAKCYHGLAKNGNLSNFCVNFEQISQFHT 60 Query: 20 YPSRIS 3 P R+S Sbjct: 61 NPFRVS 66