BLASTX nr result
ID: Paeonia23_contig00032696
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00032696 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004308197.1| PREDICTED: pentatricopeptide repeat-containi... 119 3e-25 ref|XP_007220255.1| hypothetical protein PRUPE_ppa001444mg [Prun... 119 3e-25 ref|XP_007010747.1| Pentatricopeptide repeat (PPR) superfamily p... 117 2e-24 gb|EXB44298.1| hypothetical protein L484_012217 [Morus notabilis] 115 8e-24 gb|EYU40350.1| hypothetical protein MIMGU_mgv1a021272mg [Mimulus... 114 1e-23 ref|XP_004168907.1| PREDICTED: pentatricopeptide repeat-containi... 114 2e-23 ref|XP_004147126.1| PREDICTED: pentatricopeptide repeat-containi... 114 2e-23 ref|XP_002892635.1| pentatricopeptide repeat-containing protein ... 112 7e-23 ref|NP_172596.1| pentatricopeptide repeat-containing protein [Ar... 111 9e-23 ref|XP_007148793.1| hypothetical protein PHAVU_005G014800g [Phas... 111 1e-22 ref|XP_004499782.1| PREDICTED: pentatricopeptide repeat-containi... 111 1e-22 emb|CBI40653.3| unnamed protein product [Vitis vinifera] 110 2e-22 ref|XP_002272111.1| PREDICTED: pentatricopeptide repeat-containi... 110 2e-22 ref|XP_006347159.1| PREDICTED: pentatricopeptide repeat-containi... 110 3e-22 ref|XP_003523921.1| PREDICTED: pentatricopeptide repeat-containi... 109 3e-22 ref|XP_002303960.2| hypothetical protein POPTR_0003s19010g [Popu... 109 5e-22 ref|XP_006432351.1| hypothetical protein CICLE_v10000307mg [Citr... 108 6e-22 ref|XP_006393717.1| hypothetical protein EUTSA_v10011247mg [Eutr... 108 6e-22 ref|XP_006304494.1| hypothetical protein CARUB_v10011264mg [Caps... 108 6e-22 ref|XP_003526349.1| PREDICTED: pentatricopeptide repeat-containi... 108 6e-22 >ref|XP_004308197.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Fragaria vesca subsp. vesca] Length = 827 Score = 119 bits (299), Expect = 3e-25 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 TTIHIRKNLRVCGDCHNATKY+SLVTGREIIVRDMHRFHHFKNGTCSCGDYW Sbjct: 776 TTIHIRKNLRVCGDCHNATKYISLVTGREIIVRDMHRFHHFKNGTCSCGDYW 827 >ref|XP_007220255.1| hypothetical protein PRUPE_ppa001444mg [Prunus persica] gi|462416717|gb|EMJ21454.1| hypothetical protein PRUPE_ppa001444mg [Prunus persica] Length = 827 Score = 119 bits (299), Expect = 3e-25 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 TTIHIRKNLRVCGDCHNATKY+SLVTGREIIVRDMHRFHHFKNGTCSCGDYW Sbjct: 776 TTIHIRKNLRVCGDCHNATKYISLVTGREIIVRDMHRFHHFKNGTCSCGDYW 827 >ref|XP_007010747.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508727660|gb|EOY19557.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 886 Score = 117 bits (293), Expect = 2e-24 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 T IHIRKNLRVCGDCHNATKY+SLVTGREIIVRDMHRFHHFKNGTCSCGDYW Sbjct: 835 TPIHIRKNLRVCGDCHNATKYISLVTGREIIVRDMHRFHHFKNGTCSCGDYW 886 >gb|EXB44298.1| hypothetical protein L484_012217 [Morus notabilis] Length = 814 Score = 115 bits (287), Expect = 8e-24 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 TTIHIRKNLRVCGDCHNATKY+SLV+GREIIVRDMHRFH FKNGTCSCGDYW Sbjct: 763 TTIHIRKNLRVCGDCHNATKYISLVSGREIIVRDMHRFHQFKNGTCSCGDYW 814 >gb|EYU40350.1| hypothetical protein MIMGU_mgv1a021272mg [Mimulus guttatus] Length = 791 Score = 114 bits (286), Expect = 1e-23 Identities = 49/52 (94%), Positives = 50/52 (96%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 TTIHIRKNLRVCGDCHNATKY+SLVT REIIVRDMHRFHHFKNG CSCGDYW Sbjct: 740 TTIHIRKNLRVCGDCHNATKYISLVTEREIIVRDMHRFHHFKNGVCSCGDYW 791 >ref|XP_004168907.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Cucumis sativus] Length = 821 Score = 114 bits (284), Expect = 2e-23 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 TTIH+RKNLRVCGDCHNATKY+SLVTGREIIVRDM RFHHFKNG CSCGDYW Sbjct: 770 TTIHVRKNLRVCGDCHNATKYISLVTGREIIVRDMQRFHHFKNGICSCGDYW 821 >ref|XP_004147126.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Cucumis sativus] Length = 821 Score = 114 bits (284), Expect = 2e-23 Identities = 48/52 (92%), Positives = 50/52 (96%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 TTIH+RKNLRVCGDCHNATKY+SLVTGREIIVRDM RFHHFKNG CSCGDYW Sbjct: 770 TTIHVRKNLRVCGDCHNATKYISLVTGREIIVRDMQRFHHFKNGICSCGDYW 821 >ref|XP_002892635.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338477|gb|EFH68894.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 809 Score = 112 bits (279), Expect = 7e-23 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 TTIH+RKNLRVC DCHNATKY+SLVTGREIIVRDM RFHHFKNG CSCGDYW Sbjct: 758 TTIHVRKNLRVCADCHNATKYISLVTGREIIVRDMQRFHHFKNGACSCGDYW 809 >ref|NP_172596.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122213654|sp|Q3E6Q1.1|PPR32_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g11290 gi|332190592|gb|AEE28713.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 809 Score = 111 bits (278), Expect = 9e-23 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 TTIH+RKNLRVC DCHNATKY+SLVTGREI+VRDM RFHHFKNG CSCGDYW Sbjct: 758 TTIHVRKNLRVCADCHNATKYISLVTGREIVVRDMQRFHHFKNGACSCGDYW 809 >ref|XP_007148793.1| hypothetical protein PHAVU_005G014800g [Phaseolus vulgaris] gi|561022057|gb|ESW20787.1| hypothetical protein PHAVU_005G014800g [Phaseolus vulgaris] Length = 807 Score = 111 bits (277), Expect = 1e-22 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 TTIHIRKNLRVCGDCH ATKY+SLVTGREIIVRD+ RFHHFKNG CSCGDYW Sbjct: 756 TTIHIRKNLRVCGDCHEATKYISLVTGREIIVRDLRRFHHFKNGNCSCGDYW 807 >ref|XP_004499782.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Cicer arietinum] Length = 814 Score = 111 bits (277), Expect = 1e-22 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 TTIH+RKNLRVCGDCH ATKY+SLVTGREIIVRD+ RFHHFKNG+CSCGDYW Sbjct: 763 TTIHVRKNLRVCGDCHEATKYISLVTGREIIVRDLQRFHHFKNGSCSCGDYW 814 >emb|CBI40653.3| unnamed protein product [Vitis vinifera] Length = 597 Score = 110 bits (276), Expect = 2e-22 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 TTIH+RKNLRVCGDCHNATKY+SLVT REIIVRDM RFHHFK+GTCSCGDYW Sbjct: 546 TTIHLRKNLRVCGDCHNATKYISLVTKREIIVRDMRRFHHFKDGTCSCGDYW 597 >ref|XP_002272111.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Vitis vinifera] Length = 849 Score = 110 bits (276), Expect = 2e-22 Identities = 47/52 (90%), Positives = 50/52 (96%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 TTIH+RKNLRVCGDCHNATKY+SLVT REIIVRDM RFHHFK+GTCSCGDYW Sbjct: 798 TTIHLRKNLRVCGDCHNATKYISLVTKREIIVRDMRRFHHFKDGTCSCGDYW 849 >ref|XP_006347159.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Solanum tuberosum] Length = 809 Score = 110 bits (274), Expect = 3e-22 Identities = 47/52 (90%), Positives = 48/52 (92%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 TTIHIRKNLRVCGDCH ATKY+SLV REIIVRDMHRFHHFKNG CSCGDYW Sbjct: 758 TTIHIRKNLRVCGDCHTATKYISLVMKREIIVRDMHRFHHFKNGVCSCGDYW 809 >ref|XP_003523921.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Glycine max] Length = 818 Score = 109 bits (273), Expect = 3e-22 Identities = 45/52 (86%), Positives = 50/52 (96%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 TT+HIRKNLRVCGDCH+ TKY+SLVTGREIIVRD+ RFHHFKNG+CSCGDYW Sbjct: 767 TTLHIRKNLRVCGDCHDTTKYISLVTGREIIVRDLRRFHHFKNGSCSCGDYW 818 >ref|XP_002303960.2| hypothetical protein POPTR_0003s19010g [Populus trichocarpa] gi|550343509|gb|EEE78939.2| hypothetical protein POPTR_0003s19010g [Populus trichocarpa] Length = 812 Score = 109 bits (272), Expect = 5e-22 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 T IHIRKNLRVCGDCHNATKY+SLVTGREIIVRDMHRFH FK+G CSCGDYW Sbjct: 761 TPIHIRKNLRVCGDCHNATKYISLVTGREIIVRDMHRFHLFKDGVCSCGDYW 812 >ref|XP_006432351.1| hypothetical protein CICLE_v10000307mg [Citrus clementina] gi|568883789|ref|XP_006494628.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like isoform X1 [Citrus sinensis] gi|568883791|ref|XP_006494629.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like isoform X2 [Citrus sinensis] gi|568883793|ref|XP_006494630.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like isoform X3 [Citrus sinensis] gi|568883795|ref|XP_006494631.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like isoform X4 [Citrus sinensis] gi|557534473|gb|ESR45591.1| hypothetical protein CICLE_v10000307mg [Citrus clementina] Length = 812 Score = 108 bits (271), Expect = 6e-22 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 +TIHIRKNLRVCGDCHNATKY+SLVTG EIIVRDMHRFH FKNG CSCGDYW Sbjct: 761 STIHIRKNLRVCGDCHNATKYISLVTGCEIIVRDMHRFHCFKNGVCSCGDYW 812 >ref|XP_006393717.1| hypothetical protein EUTSA_v10011247mg [Eutrema salsugineum] gi|557090295|gb|ESQ31003.1| hypothetical protein EUTSA_v10011247mg [Eutrema salsugineum] Length = 807 Score = 108 bits (271), Expect = 6e-22 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 TTIH+RKNLRVC DCHNATKY+SLVTGREIIVRDM RFHHFK G CSCGDYW Sbjct: 756 TTIHVRKNLRVCADCHNATKYISLVTGREIIVRDMQRFHHFKYGACSCGDYW 807 >ref|XP_006304494.1| hypothetical protein CARUB_v10011264mg [Capsella rubella] gi|482573205|gb|EOA37392.1| hypothetical protein CARUB_v10011264mg [Capsella rubella] Length = 811 Score = 108 bits (271), Expect = 6e-22 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 TTIH+RKNLRVC DCHNATKY+SLVT REIIVRDM RFHHFKNG CSCGDYW Sbjct: 760 TTIHVRKNLRVCADCHNATKYISLVTRREIIVRDMQRFHHFKNGVCSCGDYW 811 >ref|XP_003526349.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Glycine max] Length = 816 Score = 108 bits (271), Expect = 6e-22 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = +2 Query: 2 TTIHIRKNLRVCGDCHNATKYVSLVTGREIIVRDMHRFHHFKNGTCSCGDYW 157 T IHIRKNLRVCGDCH ATKY+SLVTGREIIVRD+ RFHHFKNG CSCGDYW Sbjct: 765 TAIHIRKNLRVCGDCHEATKYISLVTGREIIVRDLRRFHHFKNGICSCGDYW 816