BLASTX nr result
ID: Paeonia23_contig00032578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00032578 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007136053.1| hypothetical protein PHAVU_009G014000g [Phas... 56 6e-06 >ref|XP_007136053.1| hypothetical protein PHAVU_009G014000g [Phaseolus vulgaris] gi|561009140|gb|ESW08047.1| hypothetical protein PHAVU_009G014000g [Phaseolus vulgaris] Length = 853 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +2 Query: 206 MSAIASISPWIPEDDLLLKNAVEAGASLEAL 298 M A+A+++PWIPEDDLLLKNAVEAGASLE+L Sbjct: 1 MGALATLAPWIPEDDLLLKNAVEAGASLESL 31