BLASTX nr result
ID: Paeonia23_contig00032542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00032542 (620 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago ... 97 3e-18 ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago ... 89 8e-16 tpg|DAA62789.1| TPA: hypothetical protein ZEAMMB73_456670 [Zea m... 59 1e-06 >ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago truncatula] gi|355516767|gb|AES98390.1| hypothetical protein MTR_5g067940 [Medicago truncatula] Length = 69 Score = 97.4 bits (241), Expect = 3e-18 Identities = 52/69 (75%), Positives = 56/69 (81%), Gaps = 1/69 (1%) Frame = -1 Query: 401 MAKLVDATDLIGLSLGRETY*VITFKFRETLELKMGNPEPNPVFRKQTQR-FRKQE*KRI 225 MA+LVDATDLIGLSLG ETY V TFKFRETLELKMGNPEPNP FRKQ + + KRI Sbjct: 1 MAELVDATDLIGLSLGMETYQVKTFKFRETLELKMGNPEPNPSFRKQINKSLESENKKRI 60 Query: 224 GAETRRKLF 198 GAET+ KLF Sbjct: 61 GAETQWKLF 69 >ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|357471517|ref|XP_003606043.1| hypothetical protein MTR_4g051230 [Medicago truncatula] gi|358349395|ref|XP_003638723.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355504658|gb|AES85861.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355506677|gb|AES87819.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|355507098|gb|AES88240.1| hypothetical protein MTR_4g051230 [Medicago truncatula] Length = 95 Score = 89.4 bits (220), Expect = 8e-16 Identities = 48/66 (72%), Positives = 50/66 (75%), Gaps = 1/66 (1%) Frame = -1 Query: 401 MAKLVDATDLIGLSLGRETY*VITFKFRETLELKMGNPEPNPVFRKQTQR-FRKQE*KRI 225 MAKLVDATDLIGLSLG ETY V TFKFRETLELKMGNPEPNP FRKQ + + KRI Sbjct: 1 MAKLVDATDLIGLSLGMETYQVKTFKFRETLELKMGNPEPNPSFRKQINKSLESENQKRI 60 Query: 224 GAETRR 207 G R Sbjct: 61 GGGVSR 66 >tpg|DAA62789.1| TPA: hypothetical protein ZEAMMB73_456670 [Zea mays] Length = 73 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +2 Query: 272 KQDLAQDCPFLIPGFL*I*KLSLSRFPYQGSIQLSP 379 K+DLAQDCPF I GFL I KL LSRFPYQGSIQ SP Sbjct: 38 KKDLAQDCPFFIRGFLGIWKLPLSRFPYQGSIQSSP 73