BLASTX nr result
ID: Paeonia23_contig00032276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00032276 (348 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003638432.1| Craniofacial development protein [Medicago t... 44 4e-06 >ref|XP_003638432.1| Craniofacial development protein [Medicago truncatula] gi|355504367|gb|AES85570.1| Craniofacial development protein [Medicago truncatula] Length = 349 Score = 44.3 bits (103), Expect(2) = 4e-06 Identities = 21/37 (56%), Positives = 28/37 (75%) Frame = +3 Query: 135 IEVDQNIRQNIRLRIMSWNIGTLTNKSMELVDTMIRR 245 + V + + +N R+R +WNIGTLT KSME+VDTM RR Sbjct: 52 VRVKKLVHEN-RIRFGTWNIGTLTGKSMEVVDTMTRR 87 Score = 32.0 bits (71), Expect(2) = 4e-06 Identities = 17/34 (50%), Positives = 24/34 (70%) Frame = +1 Query: 4 ALPLSNTLHQPPNASINKQGVPHRQLNVMKSKQG 105 +LP SN L+ S N+QG HR+L+V+K+KQG Sbjct: 12 SLPRSNALYGSSAVS-NEQGPLHRRLDVVKNKQG 44