BLASTX nr result
ID: Paeonia23_contig00032181
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00032181 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006473429.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 89 6e-16 ref|XP_006434918.1| hypothetical protein CICLE_v10001223mg [Citr... 89 6e-16 ref|XP_006434917.1| hypothetical protein CICLE_v10001223mg [Citr... 89 6e-16 gb|EYU45097.1| hypothetical protein MIMGU_mgv1a006890mg [Mimulus... 86 5e-15 ref|XP_002510330.1| ubiquitin-protein ligase, putative [Ricinus ... 86 5e-15 ref|XP_006375047.1| hypothetical protein POPTR_0014s03910g [Popu... 86 5e-15 emb|CBI19627.3| unnamed protein product [Vitis vinifera] 84 2e-14 ref|XP_002281901.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 84 2e-14 emb|CAN79162.1| hypothetical protein VITISV_019244 [Vitis vinifera] 84 2e-14 ref|XP_006366448.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 80 3e-13 ref|XP_004291915.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 79 7e-13 ref|XP_007017442.1| F-box/RNI-like superfamily protein isoform 1... 77 3e-12 ref|XP_002302466.2| hypothetical protein POPTR_0002s13350g [Popu... 75 7e-12 gb|EXB97319.1| F-box/FBD/LRR-repeat protein [Morus notabilis] 72 8e-11 ref|XP_004298518.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 69 9e-10 ref|XP_007222553.1| hypothetical protein PRUPE_ppa006227mg [Prun... 69 9e-10 ref|XP_003550361.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 69 9e-10 gb|EPS65737.1| hypothetical protein M569_09037, partial [Genlise... 67 2e-09 ref|XP_007200766.1| hypothetical protein PRUPE_ppa023723mg [Prun... 67 2e-09 ref|XP_004499113.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 67 3e-09 >ref|XP_006473429.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X1 [Citrus sinensis] gi|568838888|ref|XP_006473430.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X2 [Citrus sinensis] gi|568838890|ref|XP_006473431.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X3 [Citrus sinensis] gi|568838892|ref|XP_006473432.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X4 [Citrus sinensis] gi|568838894|ref|XP_006473433.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X5 [Citrus sinensis] gi|568838896|ref|XP_006473434.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X6 [Citrus sinensis] gi|568838898|ref|XP_006473435.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X7 [Citrus sinensis] gi|568838900|ref|XP_006473436.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X8 [Citrus sinensis] Length = 430 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/69 (59%), Positives = 58/69 (84%) Frame = -2 Query: 309 FTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLKDMLCFSRVSA 130 F++LR VKIVGISG+ +EL I F+L+NSPVLETMT++ AS++ GW+L+K++L F R SA Sbjct: 359 FSQLRMVKIVGISGIRSELEFIKFVLSNSPVLETMTIKPASLEGGWDLIKELLRFRRASA 418 Query: 129 RAKIVVLEP 103 RA+I+ L+P Sbjct: 419 RAEIIYLDP 427 >ref|XP_006434918.1| hypothetical protein CICLE_v10001223mg [Citrus clementina] gi|567884721|ref|XP_006434919.1| hypothetical protein CICLE_v10001223mg [Citrus clementina] gi|557537040|gb|ESR48158.1| hypothetical protein CICLE_v10001223mg [Citrus clementina] gi|557537041|gb|ESR48159.1| hypothetical protein CICLE_v10001223mg [Citrus clementina] Length = 430 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/69 (59%), Positives = 58/69 (84%) Frame = -2 Query: 309 FTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLKDMLCFSRVSA 130 F++LR VKIVGISG+ +EL I F+L+NSPVLETMT++ AS++ GW+L+K++L F R SA Sbjct: 359 FSQLRMVKIVGISGIRSELEFIKFVLSNSPVLETMTIKPASLEGGWDLIKELLRFRRASA 418 Query: 129 RAKIVVLEP 103 RA+I+ L+P Sbjct: 419 RAEIIYLDP 427 >ref|XP_006434917.1| hypothetical protein CICLE_v10001223mg [Citrus clementina] gi|557537039|gb|ESR48157.1| hypothetical protein CICLE_v10001223mg [Citrus clementina] Length = 312 Score = 89.0 bits (219), Expect = 6e-16 Identities = 41/69 (59%), Positives = 58/69 (84%) Frame = -2 Query: 309 FTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLKDMLCFSRVSA 130 F++LR VKIVGISG+ +EL I F+L+NSPVLETMT++ AS++ GW+L+K++L F R SA Sbjct: 241 FSQLRMVKIVGISGIRSELEFIKFVLSNSPVLETMTIKPASLEGGWDLIKELLRFRRASA 300 Query: 129 RAKIVVLEP 103 RA+I+ L+P Sbjct: 301 RAEIIYLDP 309 >gb|EYU45097.1| hypothetical protein MIMGU_mgv1a006890mg [Mimulus guttatus] Length = 427 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/71 (59%), Positives = 55/71 (77%) Frame = -2 Query: 315 FPFTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLKDMLCFSRV 136 F F++LR +KI+GISG++ ELN I FLL N+PVLE MTV+ AS D GWEL+K++L F R Sbjct: 357 FSFSQLRLIKIIGISGIKQELNFINFLLLNTPVLEKMTVKPASTDSGWELVKELLRFRRA 416 Query: 135 SARAKIVVLEP 103 S A+IV L+P Sbjct: 417 SMFAEIVYLDP 427 >ref|XP_002510330.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223551031|gb|EEF52517.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 426 Score = 85.9 bits (211), Expect = 5e-15 Identities = 43/74 (58%), Positives = 57/74 (77%) Frame = -2 Query: 324 HLDFPFTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLKDMLCF 145 H + F +LR V+IVGISG+ EL+ + FLL+NSPVLE MTV+ AS D GWEL+K++L F Sbjct: 353 HWNNLFGQLRLVRIVGISGIRCELDFMNFLLSNSPVLERMTVKPASSDGGWELIKELLRF 412 Query: 144 SRVSARAKIVVLEP 103 R SARA+I+ L+P Sbjct: 413 RRASARAEIIYLDP 426 >ref|XP_006375047.1| hypothetical protein POPTR_0014s03910g [Populus trichocarpa] gi|550323361|gb|ERP52844.1| hypothetical protein POPTR_0014s03910g [Populus trichocarpa] Length = 416 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/69 (60%), Positives = 56/69 (81%) Frame = -2 Query: 309 FTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLKDMLCFSRVSA 130 F +LR VKIVGISG+ +EL+ I FLL+NSPVLE MTV+ ASI+ GWEL+K++L F R S Sbjct: 348 FGQLRLVKIVGISGIRSELDCIKFLLSNSPVLEQMTVKPASIEGGWELVKELLRFRRASI 407 Query: 129 RAKIVVLEP 103 +A+++ LEP Sbjct: 408 QAEVIYLEP 416 >emb|CBI19627.3| unnamed protein product [Vitis vinifera] Length = 346 Score = 84.0 bits (206), Expect = 2e-14 Identities = 43/79 (54%), Positives = 56/79 (70%) Frame = -2 Query: 339 LFRSVHLDFPFTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLK 160 L++ H ++ F LR VK+ GISGV +L+ I FLLA SPVLE MTV+ AS D WEL+K Sbjct: 268 LWKKEHWNYSFAHLRVVKLTGISGVGPQLDFINFLLAYSPVLEKMTVKPASGDGAWELIK 327 Query: 159 DMLCFSRVSARAKIVVLEP 103 D+L F R S RA+I+ L+P Sbjct: 328 DLLRFRRASVRAEIIYLDP 346 >ref|XP_002281901.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Vitis vinifera] Length = 416 Score = 84.0 bits (206), Expect = 2e-14 Identities = 43/79 (54%), Positives = 56/79 (70%) Frame = -2 Query: 339 LFRSVHLDFPFTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLK 160 L++ H ++ F LR VK+ GISGV +L+ I FLLA SPVLE MTV+ AS D WEL+K Sbjct: 338 LWKKEHWNYSFAHLRVVKLTGISGVGPQLDFINFLLAYSPVLEKMTVKPASGDGAWELIK 397 Query: 159 DMLCFSRVSARAKIVVLEP 103 D+L F R S RA+I+ L+P Sbjct: 398 DLLRFRRASVRAEIIYLDP 416 >emb|CAN79162.1| hypothetical protein VITISV_019244 [Vitis vinifera] Length = 416 Score = 84.0 bits (206), Expect = 2e-14 Identities = 43/79 (54%), Positives = 56/79 (70%) Frame = -2 Query: 339 LFRSVHLDFPFTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLK 160 L++ H ++ F LR VK+ GISGV +L+ I FLLA SPVLE MTV+ AS D WEL+K Sbjct: 338 LWKKEHWNYXFAHLRVVKLTGISGVGPQLDFINFLLAYSPVLEKMTVKPASGDGAWELIK 397 Query: 159 DMLCFSRVSARAKIVVLEP 103 D+L F R S RA+I+ L+P Sbjct: 398 DLLRFRRASVRAEIIYLDP 416 >ref|XP_006366448.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X1 [Solanum tuberosum] gi|565401937|ref|XP_006366449.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X2 [Solanum tuberosum] gi|565401939|ref|XP_006366450.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X3 [Solanum tuberosum] gi|565401941|ref|XP_006366451.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X4 [Solanum tuberosum] gi|565401943|ref|XP_006366452.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X5 [Solanum tuberosum] gi|565401945|ref|XP_006366453.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X6 [Solanum tuberosum] Length = 431 Score = 80.1 bits (196), Expect = 3e-13 Identities = 39/69 (56%), Positives = 53/69 (76%) Frame = -2 Query: 309 FTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLKDMLCFSRVSA 130 F +LR VKI GI+G++ ELN + FLL+NSPVLE MTV+ AS D WE+LK++L F R S Sbjct: 363 FNQLRHVKIAGITGLKQELNFVNFLLSNSPVLERMTVKPASADGAWEMLKELLRFRRASV 422 Query: 129 RAKIVVLEP 103 +A+IV ++P Sbjct: 423 QAEIVYVDP 431 >ref|XP_004291915.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Fragaria vesca subsp. vesca] Length = 420 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/70 (52%), Positives = 53/70 (75%) Frame = -2 Query: 312 PFTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLKDMLCFSRVS 133 PF +L+ V+I+G S + E++ I FLL+NSP+LE MTV+ AS++ GWEL+K +L F R S Sbjct: 351 PFAQLQLVRIIGTSNTQPEVDFIEFLLSNSPMLEKMTVKPASVNCGWELVKKLLQFKRAS 410 Query: 132 ARAKIVVLEP 103 A A+I+ LEP Sbjct: 411 ANAEIIYLEP 420 >ref|XP_007017442.1| F-box/RNI-like superfamily protein isoform 1 [Theobroma cacao] gi|508722770|gb|EOY14667.1| F-box/RNI-like superfamily protein isoform 1 [Theobroma cacao] Length = 432 Score = 76.6 bits (187), Expect = 3e-12 Identities = 38/74 (51%), Positives = 53/74 (71%) Frame = -2 Query: 324 HLDFPFTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLKDMLCF 145 H F LR VK+ GISGV++E++ I FLL+NSPVLE +TV+ AS D WEL+K++L F Sbjct: 359 HWSSLFAHLRLVKVSGISGVKSEMDFIKFLLSNSPVLERLTVKPASQDGEWELMKELLRF 418 Query: 144 SRVSARAKIVVLEP 103 R S A+++ L+P Sbjct: 419 RRASIYAEVIYLDP 432 >ref|XP_002302466.2| hypothetical protein POPTR_0002s13350g [Populus trichocarpa] gi|550344922|gb|EEE81739.2| hypothetical protein POPTR_0002s13350g [Populus trichocarpa] Length = 505 Score = 75.5 bits (184), Expect = 7e-12 Identities = 38/68 (55%), Positives = 51/68 (75%) Frame = -2 Query: 309 FTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLKDMLCFSRVSA 130 F +LR VKIVGISG+ +EL+ I FLL+NSPVLE MT++ S + GWEL+K +L F R S Sbjct: 437 FGQLRLVKIVGISGIRSELDCIKFLLSNSPVLEKMTIKPVSNEGGWELVKQLLHFRRASI 496 Query: 129 RAKIVVLE 106 +A++ LE Sbjct: 497 QAEVFHLE 504 >gb|EXB97319.1| F-box/FBD/LRR-repeat protein [Morus notabilis] Length = 413 Score = 72.0 bits (175), Expect = 8e-11 Identities = 35/72 (48%), Positives = 46/72 (63%) Frame = -2 Query: 318 DFPFTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLKDMLCFSR 139 + PF+KLR VKI GISG + E++ I F+L NSP LE M VE WEL+ +LCF R Sbjct: 342 NLPFSKLRVVKITGISGAKPEMDFIKFVLLNSPALERMVVEPVFTSDRWELVTKLLCFKR 401 Query: 138 VSARAKIVVLEP 103 S +A+I+ P Sbjct: 402 ASNQAEIIYKNP 413 >ref|XP_004298518.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Fragaria vesca subsp. vesca] Length = 550 Score = 68.6 bits (166), Expect = 9e-10 Identities = 36/72 (50%), Positives = 50/72 (69%) Frame = -2 Query: 318 DFPFTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLKDMLCFSR 139 +F FT LR V++ GI GV+ E++ I FLL++SPVLE MT++ S D ELLK ++ F R Sbjct: 452 NFVFTHLRVVQLTGIHGVKPEVDFIRFLLSSSPVLERMTIQPTSADCSLELLKKLVQFRR 511 Query: 138 VSARAKIVVLEP 103 VS A+I L+P Sbjct: 512 VSVDAEISYLDP 523 >ref|XP_007222553.1| hypothetical protein PRUPE_ppa006227mg [Prunus persica] gi|462419489|gb|EMJ23752.1| hypothetical protein PRUPE_ppa006227mg [Prunus persica] Length = 421 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/70 (48%), Positives = 46/70 (65%) Frame = -2 Query: 312 PFTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLKDMLCFSRVS 133 P +LR VKI GI+G + EL I LL SP LE MTV+ AS+ GWE++K +L + R S Sbjct: 352 PIARLRRVKINGIAGTKPELEFIRLLLLGSPALEKMTVKPASVTCGWEIVKKLLQYRRAS 411 Query: 132 ARAKIVVLEP 103 A+I+ L+P Sbjct: 412 VHAEIIYLDP 421 >ref|XP_003550361.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Glycine max] Length = 427 Score = 68.6 bits (166), Expect = 9e-10 Identities = 38/78 (48%), Positives = 54/78 (69%) Frame = -2 Query: 336 FRSVHLDFPFTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLKD 157 + V+ P +LR VKI GISG++ EL+ I FLL +SPVLE MTV+ + + G EL+K+ Sbjct: 350 WEDVYFSCPVMQLRYVKIDGISGIKPELDFINFLLLHSPVLERMTVKPVA-NVGLELMKE 408 Query: 156 MLCFSRVSARAKIVVLEP 103 +L F R S +A+I+ LEP Sbjct: 409 LLRFRRASGQAEIIYLEP 426 >gb|EPS65737.1| hypothetical protein M569_09037, partial [Genlisea aurea] Length = 411 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/74 (40%), Positives = 53/74 (71%) Frame = -2 Query: 324 HLDFPFTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLKDMLCF 145 + DF +LR +++VG+SG + EL+ + F+L ++PVLE +TV+ + + GW+++K++L F Sbjct: 338 YYDFALFRLRSMRVVGVSGQKLELDFVKFVLESAPVLEKVTVKPTTAECGWDVVKELLRF 397 Query: 144 SRVSARAKIVVLEP 103 R S A+IV L+P Sbjct: 398 RRASMFAEIVYLDP 411 >ref|XP_007200766.1| hypothetical protein PRUPE_ppa023723mg [Prunus persica] gi|462396166|gb|EMJ01965.1| hypothetical protein PRUPE_ppa023723mg [Prunus persica] Length = 398 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/72 (47%), Positives = 48/72 (66%) Frame = -2 Query: 312 PFTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLKDMLCFSRVS 133 PF++LR VKI +S V+A+L+ I FLL NSPVLE + V+ A D WE +K +L R S Sbjct: 321 PFSQLRFVKISNVSNVKAQLDFIRFLLLNSPVLEKIIVKPAYADDSWEQVKQLLRLGRAS 380 Query: 132 ARAKIVVLEP*F 97 ++I+ L+P F Sbjct: 381 VHSEIIFLDPSF 392 >ref|XP_004499113.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Cicer arietinum] Length = 428 Score = 67.0 bits (162), Expect = 3e-09 Identities = 36/77 (46%), Positives = 55/77 (71%) Frame = -2 Query: 336 FRSVHLDFPFTKLRCVKIVGISGVEAELNLIAFLLANSPVLETMTVELASIDRGWELLKD 157 + V+LD+P +++ V+I GISG++ EL+ I FLL SPVLE MTV+ S + G EL+K+ Sbjct: 351 WEDVYLDWPVMRVQHVRIEGISGIKPELDFINFLLLYSPVLERMTVKPVS-NAGPELVKE 409 Query: 156 MLCFSRVSARAKIVVLE 106 +L F R S RA+++ L+ Sbjct: 410 LLRFRRASGRAEVIYLD 426