BLASTX nr result
ID: Paeonia23_contig00031647
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00031647 (434 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT28316.1| ATP-citrate synthase [Aegilops tauschii] 105 5e-21 gb|AFB82642.1| ATP-citrate synthase [Camellia sinensis] 105 5e-21 ref|XP_007222546.1| hypothetical protein PRUPE_ppa006199mg [Prun... 105 7e-21 ref|XP_006358554.1| PREDICTED: ATP-citrate synthase alpha chain ... 105 9e-21 ref|XP_007163298.1| hypothetical protein PHAVU_001G222900g [Phas... 105 9e-21 ref|XP_004230349.1| PREDICTED: ATP-citrate synthase alpha chain ... 105 9e-21 ref|XP_003633614.1| PREDICTED: ATP-citrate synthase alpha chain ... 105 9e-21 ref|XP_002280514.1| PREDICTED: ATP-citrate synthase alpha chain ... 105 9e-21 emb|CAN64797.1| hypothetical protein VITISV_017316 [Vitis vinifera] 105 9e-21 ref|XP_006605258.1| PREDICTED: ATP-citrate synthase alpha chain ... 104 1e-20 ref|XP_006577202.1| PREDICTED: ATP-citrate synthase alpha chain ... 104 1e-20 ref|XP_003579058.1| PREDICTED: ATP-citrate synthase alpha chain ... 104 1e-20 ref|XP_003521649.1| PREDICTED: ATP-citrate synthase alpha chain ... 104 1e-20 gb|EYU38389.1| hypothetical protein MIMGU_mgv1a007004mg [Mimulus... 103 2e-20 gb|EXB53828.1| hypothetical protein L484_003263 [Morus notabilis] 103 2e-20 ref|XP_006840253.1| hypothetical protein AMTR_s00045p00030700 [A... 103 2e-20 ref|XP_004135571.1| PREDICTED: ATP-citrate synthase alpha chain ... 103 2e-20 ref|XP_007031235.1| ATP-citrate lyase A-3 [Theobroma cacao] gi|5... 103 3e-20 ref|XP_006480297.1| PREDICTED: ATP-citrate synthase alpha chain ... 103 3e-20 ref|XP_006428263.1| hypothetical protein CICLE_v10013702mg [Citr... 103 3e-20 >gb|EMT28316.1| ATP-citrate synthase [Aegilops tauschii] Length = 423 Score = 105 bits (263), Expect = 5e-21 Identities = 49/55 (89%), Positives = 52/55 (94%) Frame = -3 Query: 321 RAYIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMAEA 157 R IYVRRGGPNYQTGLAKMRALG ELGLP+EVYGPEATMTGICKQAI+C+MAEA Sbjct: 369 RVNIYVRRGGPNYQTGLAKMRALGSELGLPIEVYGPEATMTGICKQAIDCVMAEA 423 >gb|AFB82642.1| ATP-citrate synthase [Camellia sinensis] Length = 423 Score = 105 bits (263), Expect = 5e-21 Identities = 49/56 (87%), Positives = 54/56 (96%) Frame = -3 Query: 324 NRAYIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMAEA 157 +R +IYVRRGGPNYQTGLAKMRALGEELG+PLEVYGPEATMTGICKQAI+CIM+ A Sbjct: 368 SRMHIYVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCIMSAA 423 >ref|XP_007222546.1| hypothetical protein PRUPE_ppa006199mg [Prunus persica] gi|462419482|gb|EMJ23745.1| hypothetical protein PRUPE_ppa006199mg [Prunus persica] Length = 423 Score = 105 bits (262), Expect = 7e-21 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = -3 Query: 321 RAYIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMAE 160 R +I+VRRGGPNYQTGLAKMRALGEELG+PLEVYGPEATMTGICKQAIECIM E Sbjct: 369 RMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIECIMGE 422 >ref|XP_006358554.1| PREDICTED: ATP-citrate synthase alpha chain protein 2-like [Solanum tuberosum] Length = 423 Score = 105 bits (261), Expect = 9e-21 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = -3 Query: 321 RAYIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMAEA 157 R +IYVRRGGPNYQTGLAKMRALGEELG+PLEVYGPEATMTGICK AI+CIM+EA Sbjct: 369 RMHIYVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKGAIDCIMSEA 423 >ref|XP_007163298.1| hypothetical protein PHAVU_001G222900g [Phaseolus vulgaris] gi|561036762|gb|ESW35292.1| hypothetical protein PHAVU_001G222900g [Phaseolus vulgaris] Length = 423 Score = 105 bits (261), Expect = 9e-21 Identities = 47/55 (85%), Positives = 54/55 (98%) Frame = -3 Query: 321 RAYIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMAEA 157 R +IYVRRGGPNYQTGLAKMR+LGEELG+P++VYGPEATMTGICKQAI+CIM+EA Sbjct: 369 RVHIYVRRGGPNYQTGLAKMRSLGEELGVPIQVYGPEATMTGICKQAIDCIMSEA 423 >ref|XP_004230349.1| PREDICTED: ATP-citrate synthase alpha chain protein 3-like [Solanum lycopersicum] Length = 423 Score = 105 bits (261), Expect = 9e-21 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = -3 Query: 321 RAYIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMAEA 157 R +IYVRRGGPNYQTGLAKMRALGEELG+PLEVYGPEATMTGICK AI+CIM+EA Sbjct: 369 RMHIYVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKGAIDCIMSEA 423 >ref|XP_003633614.1| PREDICTED: ATP-citrate synthase alpha chain protein 2 isoform 2 [Vitis vinifera] Length = 435 Score = 105 bits (261), Expect = 9e-21 Identities = 48/56 (85%), Positives = 54/56 (96%) Frame = -3 Query: 324 NRAYIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMAEA 157 +R +IYVRRGGPNYQTGLA+MRALGEELG+PLEVYGPEATMTGICKQAI+CIM+ A Sbjct: 380 SRMHIYVRRGGPNYQTGLARMRALGEELGIPLEVYGPEATMTGICKQAIDCIMSTA 435 >ref|XP_002280514.1| PREDICTED: ATP-citrate synthase alpha chain protein 2 isoform 1 [Vitis vinifera] gi|296089834|emb|CBI39653.3| unnamed protein product [Vitis vinifera] Length = 423 Score = 105 bits (261), Expect = 9e-21 Identities = 48/56 (85%), Positives = 54/56 (96%) Frame = -3 Query: 324 NRAYIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMAEA 157 +R +IYVRRGGPNYQTGLA+MRALGEELG+PLEVYGPEATMTGICKQAI+CIM+ A Sbjct: 368 SRMHIYVRRGGPNYQTGLARMRALGEELGIPLEVYGPEATMTGICKQAIDCIMSTA 423 >emb|CAN64797.1| hypothetical protein VITISV_017316 [Vitis vinifera] Length = 423 Score = 105 bits (261), Expect = 9e-21 Identities = 48/56 (85%), Positives = 54/56 (96%) Frame = -3 Query: 324 NRAYIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMAEA 157 +R +IYVRRGGPNYQTGLA+MRALGEELG+PLEVYGPEATMTGICKQAI+CIM+ A Sbjct: 368 SRMHIYVRRGGPNYQTGLARMRALGEELGIPLEVYGPEATMTGICKQAIDCIMSTA 423 >ref|XP_006605258.1| PREDICTED: ATP-citrate synthase alpha chain protein 3-like [Glycine max] Length = 242 Score = 104 bits (260), Expect = 1e-20 Identities = 47/55 (85%), Positives = 54/55 (98%) Frame = -3 Query: 321 RAYIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMAEA 157 R +IYVRRGGPNYQTGLAKMRALGEELG+P++VYGPEATMTGICKQAI+CIM++A Sbjct: 188 RMHIYVRRGGPNYQTGLAKMRALGEELGVPIQVYGPEATMTGICKQAIDCIMSDA 242 >ref|XP_006577202.1| PREDICTED: ATP-citrate synthase alpha chain protein 2 isoform X2 [Glycine max] Length = 446 Score = 104 bits (259), Expect = 1e-20 Identities = 47/53 (88%), Positives = 53/53 (100%) Frame = -3 Query: 315 YIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMAEA 157 +IYVRRGGPNYQTGLAKMRALGEELG+P++VYGPEATMTGICKQAI+CIM+EA Sbjct: 394 HIYVRRGGPNYQTGLAKMRALGEELGVPIQVYGPEATMTGICKQAIDCIMSEA 446 >ref|XP_003579058.1| PREDICTED: ATP-citrate synthase alpha chain protein 3-like [Brachypodium distachyon] Length = 423 Score = 104 bits (259), Expect = 1e-20 Identities = 48/55 (87%), Positives = 52/55 (94%) Frame = -3 Query: 321 RAYIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMAEA 157 R IYVRRGGPNYQTGLAKMRALG ELGLP+EVYGPEATMTGICKQAI+C+M+EA Sbjct: 369 RMNIYVRRGGPNYQTGLAKMRALGSELGLPIEVYGPEATMTGICKQAIDCVMSEA 423 >ref|XP_003521649.1| PREDICTED: ATP-citrate synthase alpha chain protein 2 isoform X1 [Glycine max] Length = 423 Score = 104 bits (259), Expect = 1e-20 Identities = 47/53 (88%), Positives = 53/53 (100%) Frame = -3 Query: 315 YIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMAEA 157 +IYVRRGGPNYQTGLAKMRALGEELG+P++VYGPEATMTGICKQAI+CIM+EA Sbjct: 371 HIYVRRGGPNYQTGLAKMRALGEELGVPIQVYGPEATMTGICKQAIDCIMSEA 423 >gb|EYU38389.1| hypothetical protein MIMGU_mgv1a007004mg [Mimulus guttatus] Length = 423 Score = 103 bits (258), Expect = 2e-20 Identities = 46/55 (83%), Positives = 54/55 (98%) Frame = -3 Query: 321 RAYIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMAEA 157 R ++YVRRGGPNYQTGLA+MRALGEELG+P+EVYGPEATMTGICK+AI+CIM+EA Sbjct: 369 RMHLYVRRGGPNYQTGLARMRALGEELGVPIEVYGPEATMTGICKEAIDCIMSEA 423 >gb|EXB53828.1| hypothetical protein L484_003263 [Morus notabilis] Length = 225 Score = 103 bits (258), Expect = 2e-20 Identities = 48/55 (87%), Positives = 53/55 (96%) Frame = -3 Query: 321 RAYIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMAEA 157 R +IYVRRGGPNYQTGLAKMRALGEELG+ LEVYGPEATMTGICKQAI+CIM++A Sbjct: 171 RMHIYVRRGGPNYQTGLAKMRALGEELGISLEVYGPEATMTGICKQAIDCIMSQA 225 >ref|XP_006840253.1| hypothetical protein AMTR_s00045p00030700 [Amborella trichopoda] gi|548841971|gb|ERN01928.1| hypothetical protein AMTR_s00045p00030700 [Amborella trichopoda] Length = 423 Score = 103 bits (258), Expect = 2e-20 Identities = 47/56 (83%), Positives = 53/56 (94%) Frame = -3 Query: 324 NRAYIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMAEA 157 +R ++YVRRGGPNYQTGLA+MR LGEELG+PLEVYGPEATMTGICKQAIECIM+ A Sbjct: 368 SRMHVYVRRGGPNYQTGLARMRVLGEELGVPLEVYGPEATMTGICKQAIECIMSAA 423 >ref|XP_004135571.1| PREDICTED: ATP-citrate synthase alpha chain protein 2-like [Cucumis sativus] gi|449508610|ref|XP_004163361.1| PREDICTED: ATP-citrate synthase alpha chain protein 2-like [Cucumis sativus] Length = 423 Score = 103 bits (258), Expect = 2e-20 Identities = 48/55 (87%), Positives = 53/55 (96%) Frame = -3 Query: 321 RAYIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMAEA 157 R +IYVRRGGPNYQTGL+KMRALGEELG+PLEV+GPEATMTGICKQAIECIM+ A Sbjct: 369 RMHIYVRRGGPNYQTGLSKMRALGEELGVPLEVFGPEATMTGICKQAIECIMSAA 423 >ref|XP_007031235.1| ATP-citrate lyase A-3 [Theobroma cacao] gi|508719840|gb|EOY11737.1| ATP-citrate lyase A-3 [Theobroma cacao] Length = 423 Score = 103 bits (257), Expect = 3e-20 Identities = 46/55 (83%), Positives = 53/55 (96%) Frame = -3 Query: 321 RAYIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMAEA 157 R ++YVRRGGPNYQTGLA+MR LGEELG+PLEVYGPEATMTGICK+AI+CIM+EA Sbjct: 369 RMHVYVRRGGPNYQTGLARMRTLGEELGVPLEVYGPEATMTGICKEAIDCIMSEA 423 >ref|XP_006480297.1| PREDICTED: ATP-citrate synthase alpha chain protein 2-like [Citrus sinensis] Length = 423 Score = 103 bits (256), Expect = 3e-20 Identities = 47/53 (88%), Positives = 52/53 (98%) Frame = -3 Query: 321 RAYIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMA 163 R +I+VRRGGPNYQTGLAKMRALGEELG+PLEVYGPEATMTGICKQAI+CIM+ Sbjct: 369 RMHIFVRRGGPNYQTGLAKMRALGEELGIPLEVYGPEATMTGICKQAIDCIMS 421 >ref|XP_006428263.1| hypothetical protein CICLE_v10013702mg [Citrus clementina] gi|557530320|gb|ESR41503.1| hypothetical protein CICLE_v10013702mg [Citrus clementina] Length = 425 Score = 103 bits (256), Expect = 3e-20 Identities = 47/53 (88%), Positives = 52/53 (98%) Frame = -3 Query: 321 RAYIYVRRGGPNYQTGLAKMRALGEELGLPLEVYGPEATMTGICKQAIECIMA 163 R +I+VRRGGPNYQTGLAKMRALGEELG+PLEVYGPEATMTGICKQAI+CIM+ Sbjct: 371 RMHIFVRRGGPNYQTGLAKMRALGEELGIPLEVYGPEATMTGICKQAIDCIMS 423