BLASTX nr result
ID: Paeonia23_contig00031640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00031640 (274 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303485.2| SWITCH1 family protein [Populus trichocarpa]... 59 5e-07 ref|XP_006490226.1| PREDICTED: protein DYAD-like [Citrus sinensis] 59 9e-07 ref|XP_002510986.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 ref|XP_006280145.1| hypothetical protein CARUB_v10026044mg, part... 56 6e-06 >ref|XP_002303485.2| SWITCH1 family protein [Populus trichocarpa] gi|550342914|gb|EEE78464.2| SWITCH1 family protein [Populus trichocarpa] Length = 830 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/60 (51%), Positives = 42/60 (70%), Gaps = 3/60 (5%) Frame = -1 Query: 274 GWKPGENPN---ICSSEIKLLKEEMAKMKRDMMELVSKKQGEGDLAIVTTPIYCNTIYHM 104 GWKPG+NP+ +C+ EIK L+EE+AK+K +M +VSKK GE +LA+V P Y T M Sbjct: 402 GWKPGDNPSQDPVCAREIKELREEIAKIKGEMEAMVSKKHGE-ELAMVAAPNYSPTSQDM 460 >ref|XP_006490226.1| PREDICTED: protein DYAD-like [Citrus sinensis] Length = 460 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/51 (56%), Positives = 39/51 (76%), Gaps = 3/51 (5%) Frame = -1 Query: 274 GWKPGENPN---ICSSEIKLLKEEMAKMKRDMMELVSKKQGEGDLAIVTTP 131 GWKPG+NP +C++E K LKE++AK++ +M EL SKKQ E +LAIV TP Sbjct: 362 GWKPGDNPAQDPVCAAEFKQLKEDLAKIRMEMQELFSKKQ-EDNLAIVATP 411 >ref|XP_002510986.1| conserved hypothetical protein [Ricinus communis] gi|223550101|gb|EEF51588.1| conserved hypothetical protein [Ricinus communis] Length = 852 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/52 (57%), Positives = 38/52 (73%), Gaps = 3/52 (5%) Frame = -1 Query: 274 GWKPGENPN---ICSSEIKLLKEEMAKMKRDMMELVSKKQGEGDLAIVTTPI 128 GW PG+NP +C+ E K LK+E+AK+K MEL+SKK E +LAIVTTPI Sbjct: 398 GWNPGDNPTQDPLCAREFKELKQEIAKLKSRDMELLSKKH-EEELAIVTTPI 448 >ref|XP_006280145.1| hypothetical protein CARUB_v10026044mg, partial [Capsella rubella] gi|482548849|gb|EOA13043.1| hypothetical protein CARUB_v10026044mg, partial [Capsella rubella] Length = 659 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/56 (46%), Positives = 39/56 (69%), Gaps = 3/56 (5%) Frame = -1 Query: 274 GWKPGENPN---ICSSEIKLLKEEMAKMKRDMMELVSKKQGEGDLAIVTTPIYCNT 116 GWK G+NP +C+ EI+ ++EE+ +KR + +L SKK+ + +LAIVTTP C T Sbjct: 408 GWKLGDNPTQDPVCAGEIREIREELGSLKRALEKLASKKEEDQELAIVTTPNSCVT 463