BLASTX nr result
ID: Paeonia23_contig00031604
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00031604 (272 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002720156.1| ORF126 [Jatropha curcas] gi|225544183|ref|YP... 81 2e-18 ref|YP_008239213.1| hypothetical chloroplast RF15 (chloroplast) ... 54 1e-08 ref|YP_008239136.1| hypothetical chloroplast RF15 (chloroplast) ... 54 1e-08 ref|NP_043074.1| hypothetical protein ZemaCp073 [Zea mays] gi|11... 53 4e-08 gb|AFW56795.1| hypothetical protein ZEAMMB73_836054 [Zea mays] 53 5e-08 gb|ACI43242.1| unknown [Coix lacryma-jobi] gi|209361341|gb|ACI43... 53 5e-08 sp|Q06GJ8.1|YCF15_PIPCE RecName: Full=Putative uncharacterized p... 62 8e-08 sp|Q33BV4.1|YCF15_NICTO RecName: Full=Putative uncharacterized p... 60 2e-07 prf||1211235CB ORF 87 60 2e-07 ref|YP_004891652.1| ycf15 gene product (chloroplast) [Nicotiana ... 60 2e-07 ref|YP_006503835.1| hypothetical chloroplast RF15 (chloroplast) ... 60 2e-07 gb|ADZ36339.1| hypothetical protein RF15 [Franklinia alatamaha] 60 2e-07 gb|ADD72133.1| hypothetical chloroplast RF15 [Olea europaea] gi|... 60 2e-07 ref|YP_003359402.1| Ycf15 (chloroplast) [Olea europaea] gi|28379... 60 2e-07 gb|AGL45397.1| Ycf15 (chloroplast) [Sesamum indicum] 59 5e-07 ref|YP_004935711.1| ycf15 gene product (chloroplast) [Sesamum in... 59 5e-07 ref|YP_007507156.1| ycf15 protein (chloroplast) [Salvia miltiorr... 59 7e-07 ref|YP_007353976.1| Ycf15 protein (chloroplast) [Tectona grandis... 59 7e-07 ref|YP_007353959.1| Ycf15 protein (chloroplast) [Tectona grandis... 59 7e-07 gb|AFV61857.1| Ycf15 (chloroplast) [Origanum vulgare subsp. vulg... 59 9e-07 >ref|YP_002720156.1| ORF126 [Jatropha curcas] gi|225544183|ref|YP_002720173.1| ORF126 [Jatropha curcas] gi|224979608|gb|ACN72735.1| ORF126 [Jatropha curcas] gi|224979624|gb|ACN72751.1| ORF126 [Jatropha curcas] Length = 126 Score = 80.9 bits (198), Expect(2) = 2e-18 Identities = 43/56 (76%), Positives = 46/56 (82%), Gaps = 3/56 (5%) Frame = -2 Query: 217 KKW---GWVNSIIDVC*HSSLPSPFRADPKDNPVLICREYLNLNRTNHPVDIFASE 59 +KW G VNSIIDVC HSSLPSPFRA PK+NPVL+ REY LNRTN PVDIFASE Sbjct: 70 RKWVLSGRVNSIIDVCWHSSLPSPFRAYPKENPVLLGREY--LNRTNRPVDIFASE 123 Score = 37.0 bits (84), Expect(2) = 2e-18 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = -1 Query: 272 VRFRDWQLTHSVALALNVKK 213 VRFRDW+LTHSV LAL+V K Sbjct: 50 VRFRDWRLTHSVTLALDVPK 69 >ref|YP_008239213.1| hypothetical chloroplast RF15 (chloroplast) [Secale cereale] gi|521301311|gb|AGP51110.1| hypothetical chloroplast RF15 (chloroplast) [Secale cereale] Length = 132 Score = 54.3 bits (129), Expect(2) = 1e-08 Identities = 30/47 (63%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 53 ILFRSKDIH--RVVCPIQIQIFTTNKYWIIFRIGPERRRKAGMLTNV 187 +LFRSKDI R V PI I F T +YWI+FRIGPERRRKA M T++ Sbjct: 33 VLFRSKDIRGGRFVRPILI--FRTKRYWILFRIGPERRRKAEMPTDL 77 Score = 30.4 bits (67), Expect(2) = 1e-08 Identities = 17/28 (60%), Positives = 19/28 (67%), Gaps = 3/28 (10%) Frame = +1 Query: 187 LLLNSPNPI---FLTFNAKATEWVSCQS 261 L NSP+PI F T +AK TEWVS QS Sbjct: 79 LFSNSPDPIVPVFGTSSAKVTEWVSHQS 106 >ref|YP_008239136.1| hypothetical chloroplast RF15 (chloroplast) [Triticum monococcum] gi|533310149|ref|YP_008474343.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops tauschii] gi|533310244|ref|YP_008474434.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops speltoides] gi|568245040|ref|YP_008963948.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops geniculata] gi|568247036|ref|YP_008963869.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops cylindrica] gi|384406896|gb|AFH89553.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops tauschii] gi|394986535|gb|AFN42416.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops speltoides] gi|521300994|gb|AGP50797.1| hypothetical chloroplast RF15 (chloroplast) [Hordeum vulgare subsp. vulgare] gi|521301072|gb|AGP50874.1| hypothetical chloroplast RF15 (chloroplast) [Hordeum vulgare subsp. spontaneum] gi|521301153|gb|AGP50954.1| hypothetical chloroplast RF15 (chloroplast) [Hordeum vulgare subsp. spontaneum] gi|521301234|gb|AGP51034.1| hypothetical chloroplast RF15 (chloroplast) [Triticum monococcum] gi|521301391|gb|AGP51189.1| hypothetical chloroplast RF15 (chloroplast) [Triticum monococcum subsp. aegilopoides] gi|521301530|gb|AGP51326.1| hypothetical chloroplast RF2 (chloroplast) [Triticum aestivum] gi|554515596|gb|AGY92899.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops cylindrica] gi|554515676|gb|AGY92978.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops geniculata] Length = 132 Score = 54.3 bits (129), Expect(2) = 1e-08 Identities = 30/47 (63%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = +2 Query: 53 ILFRSKDIH--RVVCPIQIQIFTTNKYWIIFRIGPERRRKAGMLTNV 187 +LFRSKDI R V PI I F T +YWI+FRIGPERRRKA M T++ Sbjct: 33 VLFRSKDIRGGRFVRPILI--FRTKRYWILFRIGPERRRKAEMPTDL 77 Score = 30.4 bits (67), Expect(2) = 1e-08 Identities = 17/28 (60%), Positives = 19/28 (67%), Gaps = 3/28 (10%) Frame = +1 Query: 187 LLLNSPNPI---FLTFNAKATEWVSCQS 261 L NSP+PI F T +AK TEWVS QS Sbjct: 79 LFSNSPDPIVPVFGTSSAKVTEWVSHQS 106 >ref|NP_043074.1| hypothetical protein ZemaCp073 [Zea mays] gi|11467272|ref|NP_043104.1| hypothetical protein ZemaCp103 [Zea mays] gi|48478719|ref|YP_024326.1| hypothetical protein PS017 [Saccharum hybrid cultivar SP-80-3280] gi|48478746|ref|YP_024354.1| hypothetical protein PS069 [Saccharum hybrid cultivar SP-80-3280] gi|50812578|ref|YP_054680.1| hypothetical protein SaofCp074 [Saccharum hybrid cultivar NCo 310] gi|50812612|ref|YP_054713.1| hypothetical protein SaofCp107 [Saccharum hybrid cultivar NCo 310] gi|1175657|sp|P46666.1|YCF15_MAIZE RecName: Full=Putative uncharacterized protein ycf15; AltName: Full=ORF 99 gi|75121190|sp|Q6ENR3.1|YCF15_SACOF RecName: Full=Putative uncharacterized protein ycf15; AltName: Full=ORF99 gi|75126320|sp|Q6L3C4.1|YCF15_SACHY RecName: Full=Putative uncharacterized protein ycf15 gi|902271|emb|CAA60336.1| hypothetical protein [Zea mays] gi|902301|emb|CAA60365.1| hypothetical protein [Zea mays] gi|48478621|gb|AAT44641.1| hypothetical protein PS017 [Saccharum hybrid cultivar SP80-3280] gi|48478648|gb|AAT44668.1| unknown [Saccharum hybrid cultivar SP80-3280] gi|49659562|dbj|BAD27343.1| hypothetical protein [Saccharum hybrid cultivar NCo 310] gi|49659596|dbj|BAD27377.1| hypothetical protein [Saccharum hybrid cultivar NCo 310] gi|413917695|gb|AFW57627.1| putative uncharacterized protein ycf15 [Zea mays] gi|413948214|gb|AFW80863.1| putative uncharacterized protein ycf15 [Zea mays] gi|605059503|gb|AHV90369.1| hypothetical chloroplast RF15 (chloroplast) [Setaria italica] gi|605059522|gb|AHV90388.1| hypothetical chloroplast RF15 (chloroplast) [Setaria italica] Length = 99 Score = 52.8 bits (125), Expect(2) = 4e-08 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = +2 Query: 44 ILIILFRSKDIH--RVVCPIQIQIFTTNKYWIIFRIGPERRRKAGMLTNV 187 +LI+LFRSKDI R V PI I F T + WI+FRIGPERRR+A M T++ Sbjct: 1 MLIVLFRSKDIRGGRFVRPILI--FRTKRSWILFRIGPERRREAEMPTDL 48 Score = 30.4 bits (67), Expect(2) = 4e-08 Identities = 17/28 (60%), Positives = 19/28 (67%), Gaps = 3/28 (10%) Frame = +1 Query: 187 LLLNSPNPI---FLTFNAKATEWVSCQS 261 L NSP+PI F T +AK TEWVS QS Sbjct: 50 LFSNSPDPIVPVFGTSSAKVTEWVSHQS 77 >gb|AFW56795.1| hypothetical protein ZEAMMB73_836054 [Zea mays] Length = 99 Score = 52.8 bits (125), Expect(2) = 5e-08 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = +2 Query: 44 ILIILFRSKDIH--RVVCPIQIQIFTTNKYWIIFRIGPERRRKAGMLTNV 187 +LI+LFRSKDI R V PI I F T + WI+FRIGPERRR+A M T++ Sbjct: 1 MLIVLFRSKDIRGGRFVRPILI--FRTKRSWILFRIGPERRREAEMPTDL 48 Score = 30.0 bits (66), Expect(2) = 5e-08 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 3/28 (10%) Frame = +1 Query: 187 LLLNSPN---PIFLTFNAKATEWVSCQS 261 L NSP+ P+F T +AK TEWVS QS Sbjct: 50 LFSNSPDLIVPVFGTSSAKVTEWVSHQS 77 >gb|ACI43242.1| unknown [Coix lacryma-jobi] gi|209361341|gb|ACI43256.1| unknown [Coix lacryma-jobi] Length = 99 Score = 52.8 bits (125), Expect(2) = 5e-08 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = +2 Query: 44 ILIILFRSKDIH--RVVCPIQIQIFTTNKYWIIFRIGPERRRKAGMLTNV 187 +LI+LFRSKDI R V PI I F T + WI+FRIGPERRR+A M T++ Sbjct: 1 MLIVLFRSKDIRGGRFVRPILI--FRTKRSWILFRIGPERRREAEMPTDL 48 Score = 30.0 bits (66), Expect(2) = 5e-08 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 3/28 (10%) Frame = +1 Query: 187 LLLNSPN---PIFLTFNAKATEWVSCQS 261 L NSP+ P+F T +AK TEWVS QS Sbjct: 50 LFSNSPDRIVPVFGTSSAKVTEWVSHQS 77 >sp|Q06GJ8.1|YCF15_PIPCE RecName: Full=Putative uncharacterized protein ycf15 gi|112253795|gb|ABI14516.1| hypothetical protein RF15 [Piper cenocladum] gi|112253812|gb|ABI14533.1| hypothetical protein RF15 [Piper cenocladum] Length = 88 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +2 Query: 101 IQIFTTNKYWIIFRIGPERRRKAGMLTNVYY*IHPT 208 IQIFTT +YWI+FRIGPERR KA M T+VYY IHPT Sbjct: 52 IQIFTTERYWILFRIGPERRGKARMPTDVYYLIHPT 87 >sp|Q33BV4.1|YCF15_NICTO RecName: Full=Putative uncharacterized protein ycf15 gi|80750972|dbj|BAE48048.1| Ycf15 protein [Nicotiana tomentosiformis] gi|80751005|dbj|BAE48081.1| Ycf15 protein [Nicotiana tomentosiformis] Length = 87 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 101 IQIFTTNKYWIIFRIGPERRRKAGMLTNVYY 193 +QIFTT KYWI+FRIGPERRRKAGM T VYY Sbjct: 52 VQIFTTKKYWILFRIGPERRRKAGMPTGVYY 82 >prf||1211235CB ORF 87 Length = 87 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 101 IQIFTTNKYWIIFRIGPERRRKAGMLTNVYY 193 +QIFTT KYWI+FRIGPERRRKAGM T VYY Sbjct: 52 VQIFTTKKYWILFRIGPERRRKAGMPTGVYY 82 >ref|YP_004891652.1| ycf15 gene product (chloroplast) [Nicotiana undulata] gi|351653957|ref|YP_004891684.1| ycf15 gene product (chloroplast) [Nicotiana undulata] gi|394831164|ref|YP_006503853.1| hypothetical chloroplast RF15 (chloroplast) [Datura stramonium] gi|404474569|ref|YP_006666074.1| Ycf15 protein (chloroplast) [Capsicum annuum] gi|404474586|ref|YP_006666091.1| Ycf15 protein (chloroplast) [Capsicum annuum] gi|122201807|sp|Q2MIE3.1|YCF15_SOLBU RecName: Full=Putative uncharacterized protein ycf15 gi|122209875|sp|Q2VED6.1|YCF15_SOLTU RecName: Full=Putative uncharacterized protein ycf15 gi|122213578|sp|Q3C1N3.1|YCF15_NICSY RecName: Full=Putative uncharacterized protein ycf15 gi|4388759|emb|CAA77386.1| Ycf15 protein [Nicotiana tabacum] gi|4388763|emb|CAA77407.1| hypothetical protein [Nicotiana tabacum] gi|77799610|dbj|BAE46699.1| Ycf15 protein [Nicotiana sylvestris] gi|77799643|dbj|BAE46732.1| Ycf15 protein [Nicotiana sylvestris] gi|82754668|gb|ABB90082.1| ycf15 protein [Solanum tuberosum] gi|82754684|gb|ABB90098.1| ycf15 protein [Solanum tuberosum] gi|84371939|gb|ABC56257.1| hypothetical chloroplast RF15 [Solanum bulbocastanum] gi|84371958|gb|ABC56276.1| hypothetical chloroplast RF15 [Solanum bulbocastanum] gi|88656847|gb|ABD47100.1| hypothetical chloroplast RF15 [Solanum tuberosum] gi|88656865|gb|ABD47118.1| hypothetical chloroplast RF15 [Solanum tuberosum] gi|329124626|gb|AEB72183.1| hypothetical chloroplast RF15 (chloroplast) [Solanum tuberosum] gi|329124643|gb|AEB72200.1| hypothetical chloroplast RF15 (chloroplast) [Solanum tuberosum] gi|329124713|gb|AEB72269.1| hypothetical chloroplast RF15 (chloroplast) [Solanum tuberosum] gi|329124730|gb|AEB72286.1| hypothetical chloroplast RF15 (chloroplast) [Solanum tuberosum] gi|347453955|gb|AEO95613.1| hypothetical chloroplast RF15 (chloroplast) [Nicotiana undulata] gi|347453983|gb|AEO95641.1| hypothetical chloroplast RF15 (chloroplast) [Nicotiana undulata] gi|347454066|gb|AEO95723.1| hypothetical chloroplast RF15 [synthetic construct] gi|347454092|gb|AEO95749.1| hypothetical chloroplast RF15 [synthetic construct] gi|350996487|gb|AEQ36999.1| hypothetical chloroplast RF15 (chloroplast) [Datura stramonium] gi|350996575|gb|AEQ37086.1| hypothetical chloroplast RF15 [Datura stramonium] gi|401065976|gb|AFP90820.1| Ycf15 protein (chloroplast) [Capsicum annuum] gi|401065993|gb|AFP90837.1| Ycf15 protein (chloroplast) [Capsicum annuum] Length = 87 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 101 IQIFTTNKYWIIFRIGPERRRKAGMLTNVYY 193 +QIFTT KYWI+FRIGPERRRKAGM T VYY Sbjct: 52 VQIFTTKKYWILFRIGPERRRKAGMPTGVYY 82 >ref|YP_006503835.1| hypothetical chloroplast RF15 (chloroplast) [Datura stramonium] gi|140322|sp|P12195.1|YCF15_TOBAC RecName: Full=Putative uncharacterized protein ycf15; AltName: Full=ORF 70; AltName: Full=ORF 87 gi|75139596|sp|Q7FNR5.1|YCF15_ATRBE RecName: Full=Putative uncharacterized protein ycf15 gi|20068375|emb|CAC88088.1| ycf15 protein [Atropa belladonna] gi|20068394|emb|CAC88107.1| ycf15 protein [Atropa belladonna] gi|350996470|gb|AEQ36982.1| hypothetical chloroplast RF15 (chloroplast) [Datura stramonium] gi|350996556|gb|AEQ37067.1| hypothetical chloroplast RF15 [Datura stramonium] Length = 70 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 101 IQIFTTNKYWIIFRIGPERRRKAGMLTNVYY 193 +QIFTT KYWI+FRIGPERRRKAGM T VYY Sbjct: 35 VQIFTTKKYWILFRIGPERRRKAGMPTGVYY 65 >gb|ADZ36339.1| hypothetical protein RF15 [Franklinia alatamaha] Length = 82 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 101 IQIFTTNKYWIIFRIGPERRRKAGMLTNVYY 193 +QIFTT KYWI+FRIGPERRRKAGM T VYY Sbjct: 52 VQIFTTKKYWILFRIGPERRRKAGMPTGVYY 82 >gb|ADD72133.1| hypothetical chloroplast RF15 [Olea europaea] gi|291059316|gb|ADD72152.1| hypothetical chloroplast RF15 [Olea europaea] Length = 67 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 101 IQIFTTNKYWIIFRIGPERRRKAGMLTNVYY 193 +QIFTT KYWI+FRIGPERRRKAGM T VYY Sbjct: 37 VQIFTTKKYWILFRIGPERRRKAGMPTGVYY 67 >ref|YP_003359402.1| Ycf15 (chloroplast) [Olea europaea] gi|283795029|ref|YP_003359420.1| Ycf15 (chloroplast) [Olea europaea] gi|330850786|ref|YP_004376464.1| Ycf15 protein [Olea europaea subsp. europaea] gi|330850804|ref|YP_004376482.1| Ycf15 protein [Olea europaea subsp. europaea] gi|334700325|ref|YP_004563824.1| Ycf15 protein [Olea europaea subsp. cuspidata] gi|334700343|ref|YP_004563842.1| Ycf15 protein [Olea europaea subsp. cuspidata] gi|334701662|ref|YP_004564047.1| Ycf15 protein [Olea woodiana subsp. woodiana] gi|334701680|ref|YP_004564065.1| Ycf15 protein [Olea woodiana subsp. woodiana] gi|334701931|ref|YP_004564540.1| Ycf15 protein [Olea europaea subsp. maroccana] gi|334701949|ref|YP_004564558.1| Ycf15 protein [Olea europaea subsp. maroccana] gi|281428730|gb|ADA69969.1| Ycf15 (chloroplast) [Olea europaea] gi|281428748|gb|ADA69987.1| Ycf15 (chloroplast) [Olea europaea] gi|328795476|emb|CBR30358.1| Ycf15 protein [Olea europaea subsp. europaea] gi|328795494|emb|CBR30376.1| Ycf15 protein [Olea europaea subsp. europaea] gi|334084444|emb|CBR23874.1| Ycf15 protein [Olea europaea subsp. cuspidata] gi|334084462|emb|CBR23892.1| Ycf15 protein [Olea europaea subsp. cuspidata] gi|334084530|emb|CBR24667.1| Ycf15 protein [Olea europaea subsp. europaea] gi|334084548|emb|CBR24686.1| Ycf15 protein [Olea europaea subsp. europaea] gi|334084616|emb|CBR30451.1| Ycf15 protein [Olea europaea subsp. europaea] gi|334084634|emb|CBR30470.1| Ycf15 protein [Olea europaea subsp. europaea] gi|334084702|emb|CBS29395.1| Ycf15 protein [Olea woodiana subsp. woodiana] gi|334084720|emb|CBS29414.1| Ycf15 protein [Olea woodiana subsp. woodiana] gi|334084907|emb|CBS29286.1| Ycf15 protein [Olea europaea subsp. maroccana] gi|334084925|emb|CBS29311.1| Ycf15 protein [Olea europaea subsp. maroccana] gi|334084993|emb|CBJ04341.1| Ycf15 protein [Olea europaea subsp. cuspidata] gi|334085011|emb|CBJ04359.1| Ycf15 protein [Olea europaea subsp. cuspidata] gi|334085079|emb|CBR23782.1| Ycf15 protein [Olea europaea subsp. cuspidata] gi|334085097|emb|CBR23800.1| Ycf15 protein [Olea europaea subsp. cuspidata] gi|510934447|emb|CCQ09145.1| Ycf15 protein (chloroplast) [Olea europaea subsp. europaea] gi|510934465|emb|CCQ09163.1| Ycf15 protein (chloroplast) [Olea europaea subsp. europaea] Length = 49 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 101 IQIFTTNKYWIIFRIGPERRRKAGMLTNVYY 193 +QIFTT KYWI+FRIGPERRRKAGM T VYY Sbjct: 19 VQIFTTKKYWILFRIGPERRRKAGMPTGVYY 49 >gb|AGL45397.1| Ycf15 (chloroplast) [Sesamum indicum] Length = 65 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 101 IQIFTTNKYWIIFRIGPERRRKAGMLTNVYY 193 +QIFTT KYWI+FRIGPERRRK GM T+VYY Sbjct: 35 VQIFTTKKYWILFRIGPERRRKGGMPTDVYY 65 >ref|YP_004935711.1| ycf15 gene product (chloroplast) [Sesamum indicum] gi|359422323|ref|YP_004935728.1| ycf15 gene product (chloroplast) [Sesamum indicum] gi|347448340|gb|AEO92751.1| ycf15 protein (chloroplast) [Sesamum indicum] gi|347448357|gb|AEO92768.1| ycf15 protein (chloroplast) [Sesamum indicum] gi|496538645|gb|AGL45380.1| Ycf15 (chloroplast) [Sesamum indicum] Length = 82 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 101 IQIFTTNKYWIIFRIGPERRRKAGMLTNVYY 193 +QIFTT KYWI+FRIGPERRRK GM T+VYY Sbjct: 52 VQIFTTKKYWILFRIGPERRRKGGMPTDVYY 82 >ref|YP_007507156.1| ycf15 protein (chloroplast) [Salvia miltiorrhiza] gi|459014555|ref|YP_007507173.1| ycf15 protein (chloroplast) [Salvia miltiorrhiza] gi|401879786|gb|AFQ30973.1| ycf15 protein (chloroplast) [Salvia miltiorrhiza] gi|401879805|gb|AFQ30992.1| ycf15 protein (chloroplast) [Salvia miltiorrhiza] gi|573461996|emb|CCQ71665.1| Ycf15 (chloroplast) [Salvia miltiorrhiza] gi|573462015|emb|CCQ71684.1| Ycf15 (chloroplast) [Salvia miltiorrhiza] Length = 82 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +2 Query: 101 IQIFTTNKYWIIFRIGPERRRKAGMLTNVYY 193 +QIFTT KYWI+FRIGPERRRK GM T VYY Sbjct: 52 VQIFTTKKYWILFRIGPERRRKGGMPTGVYY 82 >ref|YP_007353976.1| Ycf15 protein (chloroplast) [Tectona grandis] gi|438687665|emb|CCP47195.1| ycf15 protein (chloroplast) [Tectona grandis] gi|438688349|emb|CCP47284.1| ycf15 protein (chloroplast) [Tectona grandis] gi|438688473|emb|CCP47373.1| ycf15 protein (chloroplast) [Tectona grandis] Length = 82 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +2 Query: 101 IQIFTTNKYWIIFRIGPERRRKAGMLTNVYY 193 +QIFTT KYWI+FRIGPERRRK GM T VYY Sbjct: 52 VQIFTTKKYWILFRIGPERRRKGGMPTGVYY 82 >ref|YP_007353959.1| Ycf15 protein (chloroplast) [Tectona grandis] gi|438687648|emb|CCP47175.1| hypothetical protein BN828_cpI0890 (chloroplast) [Tectona grandis] gi|438688332|emb|CCP47264.1| hypothetical protein BN828_cpII0890 (chloroplast) [Tectona grandis] gi|438688456|emb|CCP47353.1| hypothetical protein BN828_cpIII0890 (chloroplast) [Tectona grandis] Length = 65 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +2 Query: 101 IQIFTTNKYWIIFRIGPERRRKAGMLTNVYY 193 +QIFTT KYWI+FRIGPERRRK GM T VYY Sbjct: 35 VQIFTTKKYWILFRIGPERRRKGGMPTGVYY 65 >gb|AFV61857.1| Ycf15 (chloroplast) [Origanum vulgare subsp. vulgare] gi|410176215|gb|AFV61874.1| Ycf15 (chloroplast) [Origanum vulgare subsp. vulgare] Length = 82 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +2 Query: 101 IQIFTTNKYWIIFRIGPERRRKAGMLTNVYY 193 +QIFTT KYWI+FR+GPERRRK GM T VYY Sbjct: 52 VQIFTTKKYWILFRVGPERRRKGGMPTGVYY 82