BLASTX nr result
ID: Paeonia23_contig00031522
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00031522 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004305327.1| PREDICTED: putative pentatricopeptide repeat... 56 6e-06 >ref|XP_004305327.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g11460-like [Fragaria vesca subsp. vesca] Length = 518 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +3 Query: 51 VFVQSSLVTIYSQNGEIFNSEMIFGEMDVKNMVTWTG**RVMCKLGFMK 197 VFVQSSLV++Y+QNGE NSE++F +M V+N+V+WT K GF K Sbjct: 86 VFVQSSLVSMYAQNGETLNSELVFNKMVVRNIVSWTAMIAGYVKNGFYK 134