BLASTX nr result
ID: Paeonia23_contig00030192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00030192 (224 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15662.3| unnamed protein product [Vitis vinifera] 117 1e-24 ref|XP_002280013.1| PREDICTED: pentatricopeptide repeat-containi... 117 1e-24 emb|CAN62482.1| hypothetical protein VITISV_010810 [Vitis vinifera] 117 1e-24 ref|XP_004148701.1| PREDICTED: pentatricopeptide repeat-containi... 115 8e-24 ref|XP_006477030.1| PREDICTED: pentatricopeptide repeat-containi... 114 1e-23 ref|XP_006440110.1| hypothetical protein CICLE_v10019093mg [Citr... 113 2e-23 ref|XP_007037975.1| Pentatricopeptide repeat superfamily protein... 113 3e-23 ref|XP_007217008.1| hypothetical protein PRUPE_ppa002164mg [Prun... 111 1e-22 ref|XP_003533538.1| PREDICTED: pentatricopeptide repeat-containi... 108 8e-22 ref|XP_003531467.1| PREDICTED: pentatricopeptide repeat-containi... 108 1e-21 ref|XP_007162601.1| hypothetical protein PHAVU_001G165000g [Phas... 107 2e-21 ref|XP_004499791.1| PREDICTED: pentatricopeptide repeat-containi... 106 3e-21 ref|XP_004304293.1| PREDICTED: pentatricopeptide repeat-containi... 105 5e-21 gb|EYU43052.1| hypothetical protein MIMGU_mgv1a0021231mg, partia... 104 1e-20 ref|XP_006367434.1| PREDICTED: pentatricopeptide repeat-containi... 104 1e-20 ref|XP_004243699.1| PREDICTED: pentatricopeptide repeat-containi... 104 1e-20 ref|XP_003571366.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 gb|EMT12320.1| hypothetical protein F775_11049 [Aegilops tauschii] 102 4e-20 gb|AFW61270.1| hypothetical protein ZEAMMB73_216321 [Zea mays] 102 6e-20 ref|XP_002463828.1| hypothetical protein SORBIDRAFT_01g006970 [S... 102 7e-20 >emb|CBI15662.3| unnamed protein product [Vitis vinifera] Length = 657 Score = 117 bits (294), Expect = 1e-24 Identities = 53/64 (82%), Positives = 57/64 (89%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 AIAFGLINT D TPL I+QSHRICGDCH IKLIA+VT+R IVV+DASRFHHFKDG CSC Sbjct: 594 AIAFGLINTSDWTPLQIVQSHRICGDCHSAIKLIALVTRREIVVRDASRFHHFKDGSCSC 653 Query: 44 GDYW 33 GDYW Sbjct: 654 GDYW 657 >ref|XP_002280013.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Vitis vinifera] Length = 704 Score = 117 bits (294), Expect = 1e-24 Identities = 53/64 (82%), Positives = 57/64 (89%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 AIAFGLINT D TPL I+QSHRICGDCH IKLIA+VT+R IVV+DASRFHHFKDG CSC Sbjct: 641 AIAFGLINTSDWTPLQIVQSHRICGDCHSAIKLIALVTRREIVVRDASRFHHFKDGSCSC 700 Query: 44 GDYW 33 GDYW Sbjct: 701 GDYW 704 >emb|CAN62482.1| hypothetical protein VITISV_010810 [Vitis vinifera] Length = 704 Score = 117 bits (294), Expect = 1e-24 Identities = 53/64 (82%), Positives = 57/64 (89%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 AIAFGLINT D TPL I+QSHRICGDCH IKLIA+VT+R IVV+DASRFHHFKDG CSC Sbjct: 641 AIAFGLINTSDWTPLQIVQSHRICGDCHSAIKLIALVTRREIVVRDASRFHHFKDGSCSC 700 Query: 44 GDYW 33 GDYW Sbjct: 701 GDYW 704 >ref|XP_004148701.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Cucumis sativus] gi|449517215|ref|XP_004165641.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Cucumis sativus] Length = 706 Score = 115 bits (287), Expect = 8e-24 Identities = 49/64 (76%), Positives = 57/64 (89%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 AIA+GL+NT + TPL I+QSHRIC DCH VIKLIAM+TKR IV++DASRFHHF+DG CSC Sbjct: 643 AIAYGLLNTLEKTPLQIVQSHRICSDCHSVIKLIAMITKREIVIRDASRFHHFRDGSCSC 702 Query: 44 GDYW 33 GDYW Sbjct: 703 GDYW 706 >ref|XP_006477030.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Citrus sinensis] Length = 703 Score = 114 bits (285), Expect = 1e-23 Identities = 52/64 (81%), Positives = 56/64 (87%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 A+AFGLINT D TPL I+QSHRIC DCH+ IKLIAMVT R IVV+DASRFHHFKDG CSC Sbjct: 640 AVAFGLINTSDWTPLQIVQSHRICCDCHNAIKLIAMVTGREIVVRDASRFHHFKDGMCSC 699 Query: 44 GDYW 33 GDYW Sbjct: 700 GDYW 703 >ref|XP_006440110.1| hypothetical protein CICLE_v10019093mg [Citrus clementina] gi|557542372|gb|ESR53350.1| hypothetical protein CICLE_v10019093mg [Citrus clementina] Length = 703 Score = 113 bits (283), Expect = 2e-23 Identities = 52/64 (81%), Positives = 56/64 (87%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 A+AFGLINT D TPL I+QSHRIC DCH+ IKLIAMVT R IVV+DASRFHHFKDG CSC Sbjct: 640 AVAFGLINTSDWTPLQIVQSHRICCDCHNAIKLIAMVTGREIVVRDASRFHHFKDGICSC 699 Query: 44 GDYW 33 GDYW Sbjct: 700 GDYW 703 >ref|XP_007037975.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] gi|508775220|gb|EOY22476.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 702 Score = 113 bits (282), Expect = 3e-23 Identities = 50/64 (78%), Positives = 56/64 (87%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 AIAFGLINT + PL I+QSHRIC DCH+ IKLIA+VT+R IVV+DASRFHHFKDG CSC Sbjct: 639 AIAFGLINTTNGLPLQIVQSHRICNDCHNAIKLIALVTRREIVVRDASRFHHFKDGSCSC 698 Query: 44 GDYW 33 GDYW Sbjct: 699 GDYW 702 >ref|XP_007217008.1| hypothetical protein PRUPE_ppa002164mg [Prunus persica] gi|462413158|gb|EMJ18207.1| hypothetical protein PRUPE_ppa002164mg [Prunus persica] Length = 706 Score = 111 bits (277), Expect = 1e-22 Identities = 49/64 (76%), Positives = 55/64 (85%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 AIA+GLI+T D TPL I+QSHRICGDCH +KLIA VT R IVV+DASRFHHFKDG CSC Sbjct: 643 AIAYGLISTADGTPLQIVQSHRICGDCHSAVKLIARVTGREIVVRDASRFHHFKDGSCSC 702 Query: 44 GDYW 33 G+YW Sbjct: 703 GNYW 706 >ref|XP_003533538.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Glycine max] Length = 690 Score = 108 bits (270), Expect = 8e-22 Identities = 49/64 (76%), Positives = 52/64 (81%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 AIAFGLINT TPL I Q HR+CGDCH IK IAMVT R IVV+DASRFHHF+DG CSC Sbjct: 627 AIAFGLINTPHWTPLQITQGHRVCGDCHSAIKFIAMVTGREIVVRDASRFHHFRDGSCSC 686 Query: 44 GDYW 33 GDYW Sbjct: 687 GDYW 690 >ref|XP_003531467.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Glycine max] Length = 691 Score = 108 bits (269), Expect = 1e-21 Identities = 49/64 (76%), Positives = 53/64 (82%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 AIAFGLINT TPL I Q HR+CGDCH IKLIAMVT R IVV+DASRFHHF++G CSC Sbjct: 628 AIAFGLINTPHWTPLQITQGHRVCGDCHSAIKLIAMVTGREIVVRDASRFHHFRNGSCSC 687 Query: 44 GDYW 33 GDYW Sbjct: 688 GDYW 691 >ref|XP_007162601.1| hypothetical protein PHAVU_001G165000g [Phaseolus vulgaris] gi|561036065|gb|ESW34595.1| hypothetical protein PHAVU_001G165000g [Phaseolus vulgaris] Length = 690 Score = 107 bits (266), Expect = 2e-21 Identities = 48/64 (75%), Positives = 53/64 (82%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 AIAFGLINT TPL I QSHR+CGDCH +KLIA VT R IV+KDASRFHHF++G CSC Sbjct: 627 AIAFGLINTPYWTPLQITQSHRVCGDCHSAVKLIAKVTGREIVIKDASRFHHFRNGSCSC 686 Query: 44 GDYW 33 GDYW Sbjct: 687 GDYW 690 >ref|XP_004499791.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Cicer arietinum] Length = 691 Score = 106 bits (265), Expect = 3e-21 Identities = 46/64 (71%), Positives = 56/64 (87%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 AIAFG+IN+ + PL I+Q HR+CGDCH+ IKLIA+VT R IV++DASRFHHFK+GRCSC Sbjct: 628 AIAFGIINSPNWLPLQIIQRHRVCGDCHNAIKLIALVTGREIVLRDASRFHHFKNGRCSC 687 Query: 44 GDYW 33 GDYW Sbjct: 688 GDYW 691 >ref|XP_004304293.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 707 Score = 105 bits (263), Expect = 5e-21 Identities = 47/64 (73%), Positives = 54/64 (84%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 AIA+GLI+T D TPL I+Q HRIC DCH IKLIA VT+R IVV+DASRFHHFK+G CSC Sbjct: 644 AIAYGLISTSDGTPLQIVQGHRICPDCHSAIKLIAKVTEREIVVRDASRFHHFKNGSCSC 703 Query: 44 GDYW 33 G+YW Sbjct: 704 GNYW 707 >gb|EYU43052.1| hypothetical protein MIMGU_mgv1a0021231mg, partial [Mimulus guttatus] Length = 703 Score = 104 bits (259), Expect = 1e-20 Identities = 46/64 (71%), Positives = 54/64 (84%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 A++FGLI+T DSTPL ++QSHRIC DCH IKLI+MV + IVV+DASRFH FKDG CSC Sbjct: 640 AVSFGLISTPDSTPLQLVQSHRICNDCHGAIKLISMVYGKEIVVRDASRFHRFKDGSCSC 699 Query: 44 GDYW 33 GDYW Sbjct: 700 GDYW 703 >ref|XP_006367434.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Solanum tuberosum] Length = 700 Score = 104 bits (259), Expect = 1e-20 Identities = 45/64 (70%), Positives = 55/64 (85%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 AI+FGLI+T ST L ++QSHRIC +CH+ IKLIAM+TKR IV++DASRFH FK+G CSC Sbjct: 637 AISFGLISTSSSTSLQLVQSHRICNNCHNAIKLIAMITKREIVIRDASRFHRFKNGTCSC 696 Query: 44 GDYW 33 GDYW Sbjct: 697 GDYW 700 >ref|XP_004243699.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Solanum lycopersicum] Length = 704 Score = 104 bits (259), Expect = 1e-20 Identities = 45/64 (70%), Positives = 55/64 (85%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 AI+FGLI+T ST L ++QSHRIC +CH+ IKLIAM+TKR IV++DASRFH FK+G CSC Sbjct: 641 AISFGLISTSSSTSLQLVQSHRICNNCHNAIKLIAMITKREIVIRDASRFHRFKNGTCSC 700 Query: 44 GDYW 33 GDYW Sbjct: 701 GDYW 704 >ref|XP_003571366.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Brachypodium distachyon] Length = 674 Score = 103 bits (258), Expect = 2e-20 Identities = 45/64 (70%), Positives = 53/64 (82%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 A+AFG+I+T STPL I QSHR+C DCH V+KL+A VTKR IV++D SRFHHFK G CSC Sbjct: 611 AVAFGIISTSPSTPLTINQSHRLCRDCHKVMKLVAQVTKREIVLRDGSRFHHFKLGTCSC 670 Query: 44 GDYW 33 GDYW Sbjct: 671 GDYW 674 >gb|EMT12320.1| hypothetical protein F775_11049 [Aegilops tauschii] Length = 504 Score = 102 bits (255), Expect = 4e-20 Identities = 45/64 (70%), Positives = 51/64 (79%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 A+AFGLI+T S PL I QSHR+C DCH+VIK + VTKR I V+DASRFHHFK G CSC Sbjct: 441 AVAFGLISTSPSAPLTINQSHRLCHDCHNVIKFVTQVTKREITVRDASRFHHFKLGTCSC 500 Query: 44 GDYW 33 GDYW Sbjct: 501 GDYW 504 >gb|AFW61270.1| hypothetical protein ZEAMMB73_216321 [Zea mays] Length = 687 Score = 102 bits (254), Expect = 6e-20 Identities = 44/64 (68%), Positives = 52/64 (81%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 AIAFGLI+T TPL I QSHR+C DCH++IK ++ VTKR I+V+D SRFHHFK G CSC Sbjct: 624 AIAFGLISTAPQTPLRISQSHRLCSDCHNLIKFVSRVTKREIIVRDGSRFHHFKLGVCSC 683 Query: 44 GDYW 33 GDYW Sbjct: 684 GDYW 687 >ref|XP_002463828.1| hypothetical protein SORBIDRAFT_01g006970 [Sorghum bicolor] gi|241917682|gb|EER90826.1| hypothetical protein SORBIDRAFT_01g006970 [Sorghum bicolor] Length = 304 Score = 102 bits (253), Expect = 7e-20 Identities = 44/64 (68%), Positives = 52/64 (81%) Frame = -1 Query: 224 AIAFGLINTCDSTPLLIMQSHRICGDCHHVIKLIAMVTKRAIVVKDASRFHHFKDGRCSC 45 AIAFGL++T TPL +M++ RICGDCH+ +KLIA VT R IVV+D RFHHFKDG CSC Sbjct: 241 AIAFGLVSTSPGTPLRVMKNLRICGDCHNAVKLIAKVTGREIVVRDNKRFHHFKDGACSC 300 Query: 44 GDYW 33 GDYW Sbjct: 301 GDYW 304