BLASTX nr result
ID: Paeonia23_contig00030093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00030093 (224 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI31103.3| unnamed protein product [Vitis vinifera] 46 5e-06 >emb|CBI31103.3| unnamed protein product [Vitis vinifera] Length = 136 Score = 45.8 bits (107), Expect(2) = 5e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = +2 Query: 119 ESRIRSLALNAHMFNLFLAVFPEIFIINATFILLI 223 E + L +HMFNLFLAV PEIFIINAT ILLI Sbjct: 52 EMKAADLRPPSHMFNLFLAVSPEIFIINATSILLI 86 Score = 30.0 bits (66), Expect(2) = 5e-06 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +3 Query: 75 EDRNVSNSVLHTGEMKAEFVR 137 E ++SNSVLHTGEMKA +R Sbjct: 39 EHLSLSNSVLHTGEMKAADLR 59