BLASTX nr result
ID: Paeonia23_contig00030024
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00030024 (433 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007027830.1| NAC domain containing protein 90 [Theobroma ... 62 4e-09 gb|AGL39695.1| NAC transcription factor 039 [Jatropha curcas] 61 2e-08 ref|XP_004291581.1| PREDICTED: NAC domain-containing protein 90-... 62 1e-07 gb|AHJ79211.1| NAC domain protein NAC70 [Gossypium hirsutum] 56 2e-07 ref|XP_007132454.1| hypothetical protein PHAVU_011G095500g [Phas... 60 4e-07 ref|XP_007132453.1| hypothetical protein PHAVU_011G095500g [Phas... 60 4e-07 ref|XP_004251070.1| PREDICTED: NAC domain-containing protein 90-... 60 4e-07 ref|XP_002523834.1| conserved hypothetical protein [Ricinus comm... 59 7e-07 ref|XP_006481732.1| PREDICTED: NAC domain-containing protein 90-... 54 8e-07 ref|XP_006430144.1| hypothetical protein CICLE_v10012468mg [Citr... 54 8e-07 ref|XP_006481733.1| PREDICTED: NAC domain-containing protein 90-... 54 8e-07 ref|XP_003538107.1| PREDICTED: NAC domain-containing protein 90-... 59 9e-07 ref|XP_007015771.1| NAC domain protein, IPR003441 [Theobroma cac... 55 1e-06 ref|XP_006362874.1| PREDICTED: NAC domain-containing protein 90-... 58 1e-06 ref|XP_002313490.1| NAC domain-containing protein 90 [Populus tr... 58 1e-06 gb|EXB91230.1| NAC domain-containing protein 90 [Morus notabilis] 57 1e-06 ref|XP_007207479.1| hypothetical protein PRUPE_ppa010337mg [Prun... 58 2e-06 ref|XP_003596841.1| NAC domain protein [Medicago truncatula] gi|... 57 2e-06 ref|XP_004506197.1| PREDICTED: NAC domain-containing protein 90-... 57 2e-06 ref|XP_002298277.2| NAC domain-containing protein 90 [Populus tr... 56 2e-06 >ref|XP_007027830.1| NAC domain containing protein 90 [Theobroma cacao] gi|508716435|gb|EOY08332.1| NAC domain containing protein 90 [Theobroma cacao] Length = 260 Score = 61.6 bits (148), Expect(2) = 4e-09 Identities = 30/48 (62%), Positives = 36/48 (75%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAIDSAITSP 356 PGYVYS + IGV+R+MVFY G AP GKK E K+NEYKAI+ +SP Sbjct: 100 PGYVYSSNSRPIGVKRTMVFYNGRAPSGKKTEWKMNEYKAIEGEASSP 147 Score = 24.6 bits (52), Expect(2) = 4e-09 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 115 HDVPKQWFYLIPIQRERSQ 171 H P+QWF+ IP Q ++ Sbjct: 63 HKDPEQWFFFIPRQESEAR 81 >gb|AGL39695.1| NAC transcription factor 039 [Jatropha curcas] Length = 257 Score = 61.2 bits (147), Expect(2) = 2e-08 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAIDSAITS 353 PGYVYS N +GV+R+MVFY G AP G+K E K+NEYKAID +S Sbjct: 100 PGYVYSSNNRCVGVKRTMVFYKGRAPRGRKTEWKMNEYKAIDREASS 146 Score = 23.1 bits (48), Expect(2) = 2e-08 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +1 Query: 124 PKQWFYLIPIQRERSQ 171 P+QWF+ IP Q ++ Sbjct: 66 PEQWFFFIPRQESEAR 81 >ref|XP_004291581.1| PREDICTED: NAC domain-containing protein 90-like [Fragaria vesca subsp. vesca] Length = 265 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/48 (56%), Positives = 37/48 (77%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAIDSAITSP 356 PGYVYS N +IGV+++MVFY G AP G+K + K+NEY+AI+ A +P Sbjct: 99 PGYVYSSDNRVIGVKKTMVFYKGKAPTGRKTKWKMNEYRAIEGAAAAP 146 >gb|AHJ79211.1| NAC domain protein NAC70 [Gossypium hirsutum] Length = 233 Score = 56.2 bits (134), Expect(2) = 2e-07 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAIDSAIT 350 PGYVYS + IGV+R+MVFY G AP GKK + K+NEYKAI ++ Sbjct: 101 PGYVYSFNSRPIGVKRTMVFYNGRAPNGKKTDWKMNEYKAIQDHVS 146 Score = 24.6 bits (52), Expect(2) = 2e-07 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 115 HDVPKQWFYLIPIQRERSQ 171 H P+QWF+ IP Q ++ Sbjct: 64 HKDPEQWFFFIPRQESEAR 82 >ref|XP_007132454.1| hypothetical protein PHAVU_011G095500g [Phaseolus vulgaris] gi|561005454|gb|ESW04448.1| hypothetical protein PHAVU_011G095500g [Phaseolus vulgaris] Length = 192 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAI 335 PGYVYS N +IGV++SMVFY G AP+G+K + K+NEYKAI Sbjct: 65 PGYVYSSDNRVIGVKKSMVFYKGKAPMGRKTKWKMNEYKAI 105 >ref|XP_007132453.1| hypothetical protein PHAVU_011G095500g [Phaseolus vulgaris] gi|561005453|gb|ESW04447.1| hypothetical protein PHAVU_011G095500g [Phaseolus vulgaris] Length = 229 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAI 335 PGYVYS N +IGV++SMVFY G AP+G+K + K+NEYKAI Sbjct: 102 PGYVYSSDNRVIGVKKSMVFYKGKAPMGRKTKWKMNEYKAI 142 >ref|XP_004251070.1| PREDICTED: NAC domain-containing protein 90-like [Solanum lycopersicum] Length = 260 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAIDSAITSPM 359 P YVYS N +IGV++SMVFY G AP GKK + K+NEY+AI + S + Sbjct: 97 PSYVYSSNNKVIGVKKSMVFYKGKAPTGKKTKWKMNEYRAIQEEVNSTL 145 >ref|XP_002523834.1| conserved hypothetical protein [Ricinus communis] gi|223536922|gb|EEF38560.1| conserved hypothetical protein [Ricinus communis] Length = 240 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/44 (59%), Positives = 35/44 (79%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAIDSA 344 PGYVYS N +IGV+++MVFY G AP G+K + K+NEY+AI+ A Sbjct: 97 PGYVYSSDNRVIGVKKTMVFYKGKAPTGRKTKWKMNEYRAIEGA 140 >ref|XP_006481732.1| PREDICTED: NAC domain-containing protein 90-like isoform X1 [Citrus sinensis] Length = 268 Score = 54.3 bits (129), Expect(2) = 8e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAIDS 341 PG VYS N +G +R+MVFY G AP G+K E K+NEYKAID+ Sbjct: 101 PGLVYSSNNRPVGEKRTMVFYRGRAPNGRKTEWKMNEYKAIDA 143 Score = 24.3 bits (51), Expect(2) = 8e-07 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 115 HDVPKQWFYLIPIQRERSQ 171 H P+QWF+ IP Q ++ Sbjct: 64 HRDPEQWFFFIPRQESEAR 82 >ref|XP_006430144.1| hypothetical protein CICLE_v10012468mg [Citrus clementina] gi|557532201|gb|ESR43384.1| hypothetical protein CICLE_v10012468mg [Citrus clementina] Length = 268 Score = 54.3 bits (129), Expect(2) = 8e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAIDS 341 PG VYS N +G +R+MVFY G AP G+K E K+NEYKAID+ Sbjct: 101 PGLVYSSNNRPVGEKRTMVFYRGRAPNGRKTEWKMNEYKAIDA 143 Score = 24.3 bits (51), Expect(2) = 8e-07 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 115 HDVPKQWFYLIPIQRERSQ 171 H P+QWF+ IP Q ++ Sbjct: 64 HRDPEQWFFFIPRQESEAR 82 >ref|XP_006481733.1| PREDICTED: NAC domain-containing protein 90-like isoform X2 [Citrus sinensis] Length = 231 Score = 54.3 bits (129), Expect(2) = 8e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAIDS 341 PG VYS N +G +R+MVFY G AP G+K E K+NEYKAID+ Sbjct: 64 PGLVYSSNNRPVGEKRTMVFYRGRAPNGRKTEWKMNEYKAIDA 106 Score = 24.3 bits (51), Expect(2) = 8e-07 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 115 HDVPKQWFYLIPIQRERSQ 171 H P+QWF+ IP Q ++ Sbjct: 27 HRDPEQWFFFIPRQESEAR 45 >ref|XP_003538107.1| PREDICTED: NAC domain-containing protein 90-like [Glycine max] Length = 246 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAI 335 PGYVYS N +IGV++SMVFY G AP+G+K + K+NEY+AI Sbjct: 98 PGYVYSSDNKVIGVKKSMVFYKGKAPMGRKTKWKMNEYRAI 138 >ref|XP_007015771.1| NAC domain protein, IPR003441 [Theobroma cacao] gi|508786134|gb|EOY33390.1| NAC domain protein, IPR003441 [Theobroma cacao] Length = 242 Score = 54.7 bits (130), Expect(3) = 1e-06 Identities = 25/48 (52%), Positives = 37/48 (77%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAIDSAITSP 356 P YVYS N +IG++++MVFY G AP G+K + K+NEY+AI+ A+ +P Sbjct: 95 PSYVYSSDNQVIGMKKTMVFYKGKAPSGRKTKWKMNEYRAIE-AVANP 141 Score = 21.9 bits (45), Expect(3) = 1e-06 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 149 PYKEKEAKGGWTN*DTTFG 205 P +EKEA+GG N T G Sbjct: 69 PRQEKEARGGRPNRTTASG 87 Score = 20.8 bits (42), Expect(3) = 1e-06 Identities = 12/44 (27%), Positives = 21/44 (47%), Gaps = 12/44 (27%) Frame = +1 Query: 76 HHNM-VMSFYFLPRHDVPK-----------QWFYLIPIQRERSQ 171 HH + V++ Y + D+P+ QWFY P Q + ++ Sbjct: 33 HHVIPVLNIYDVEPWDLPQLAGEVCKADTEQWFYFTPRQEKEAR 76 >ref|XP_006362874.1| PREDICTED: NAC domain-containing protein 90-like [Solanum tuberosum] Length = 261 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAIDSAITS 353 P YVYS + +IGV++SMVFY G AP GKK + K+NEY+AI+ + S Sbjct: 97 PSYVYSSNSKVIGVKKSMVFYKGKAPTGKKTKWKMNEYRAIEEEVNS 143 >ref|XP_002313490.1| NAC domain-containing protein 90 [Populus trichocarpa] gi|222849898|gb|EEE87445.1| NAC domain-containing protein 90 [Populus trichocarpa] Length = 227 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/42 (57%), Positives = 35/42 (83%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAID 338 PGYVYS N +IG++++MVFY+G AP G+K + K+NEY+AI+ Sbjct: 96 PGYVYSSDNRVIGLKKTMVFYIGKAPTGRKTKWKMNEYRAIE 137 >gb|EXB91230.1| NAC domain-containing protein 90 [Morus notabilis] Length = 243 Score = 57.0 bits (136), Expect(2) = 1e-06 Identities = 25/44 (56%), Positives = 36/44 (81%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAIDSA 344 PGYVYS + +IGV+++MVFY G AP G+K + K+NEY+AI++A Sbjct: 96 PGYVYSPDSKVIGVKKTMVFYKGKAPTGRKTKWKMNEYRAIEAA 139 Score = 20.8 bits (42), Expect(2) = 1e-06 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 149 PYKEKEAKGGWTN*DTTFG 205 P +E+EA+GG N T G Sbjct: 70 PRQEREARGGRPNRTTASG 88 >ref|XP_007207479.1| hypothetical protein PRUPE_ppa010337mg [Prunus persica] gi|462403121|gb|EMJ08678.1| hypothetical protein PRUPE_ppa010337mg [Prunus persica] Length = 253 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/43 (58%), Positives = 35/43 (81%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAIDS 341 PGYVYS N +IGV+++MVFY G AP G+K + K+NEY+AI++ Sbjct: 96 PGYVYSSDNKVIGVKKTMVFYKGKAPTGRKTKWKMNEYRAIEA 138 >ref|XP_003596841.1| NAC domain protein [Medicago truncatula] gi|355485889|gb|AES67092.1| NAC domain protein [Medicago truncatula] Length = 249 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/51 (52%), Positives = 38/51 (74%), Gaps = 3/51 (5%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAI---DSAITSP 356 P YVYS N +IG+R++MVFY+G AP G+K + K++EYKAI D + T+P Sbjct: 97 PSYVYSSNNKVIGIRKTMVFYIGKAPSGRKTKWKMHEYKAIQQSDQSNTNP 147 >ref|XP_004506197.1| PREDICTED: NAC domain-containing protein 90-like [Cicer arietinum] Length = 272 Score = 56.6 bits (135), Expect(2) = 2e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAI 335 PGYVYS N +IGV++SMVFY G AP G K + K+NEY+AI Sbjct: 97 PGYVYSSDNKVIGVKKSMVFYKGKAPSGNKTKWKMNEYRAI 137 Score = 20.4 bits (41), Expect(2) = 2e-06 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 149 PYKEKEAKGGWTN*DTTFG 205 P +E+EA+GG N T G Sbjct: 71 PGQEREARGGRPNRTTACG 89 >ref|XP_002298277.2| NAC domain-containing protein 90 [Populus trichocarpa] gi|550347909|gb|EEE83082.2| NAC domain-containing protein 90 [Populus trichocarpa] Length = 266 Score = 56.2 bits (134), Expect(2) = 2e-06 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = +3 Query: 213 PGYVYSHGNTIIGVRRSMVFYVG*APIGKKIE*KINEYKAID 338 PGYVYS N +IG++++MVFY G AP G+K + K+NEY+AI+ Sbjct: 117 PGYVYSSDNRVIGLKKTMVFYTGKAPRGRKTKWKMNEYRAIE 158 Score = 20.8 bits (42), Expect(2) = 2e-06 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 149 PYKEKEAKGGWTN*DTTFG 205 P +E+EA+GG N T G Sbjct: 91 PRQEREARGGRPNRTTASG 109