BLASTX nr result
ID: Paeonia23_contig00028915
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00028915 (221 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007050028.1| Uncharacterized protein TCM_003618 [Theobrom... 57 2e-06 ref|XP_007201208.1| hypothetical protein PRUPE_ppa001741mg [Prun... 56 6e-06 ref|XP_004505520.1| PREDICTED: uncharacterized protein LOC101491... 55 1e-05 >ref|XP_007050028.1| Uncharacterized protein TCM_003618 [Theobroma cacao] gi|508702289|gb|EOX94185.1| Uncharacterized protein TCM_003618 [Theobroma cacao] Length = 755 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -1 Query: 221 RAFAEYRKRCPLPGEPLYKDVPGAGGFVSSTLERQK 114 RAFAEYR CPLP EPLYKDV G+GG V ST+E +K Sbjct: 645 RAFAEYRACCPLPDEPLYKDVSGSGGLVLSTMELEK 680 >ref|XP_007201208.1| hypothetical protein PRUPE_ppa001741mg [Prunus persica] gi|462396608|gb|EMJ02407.1| hypothetical protein PRUPE_ppa001741mg [Prunus persica] Length = 772 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -1 Query: 221 RAFAEYRKRCPLPGEPLYKDVPGAGGFVSSTLERQK 114 +AFAEYR RCP EPLY+DVPG+GG V ST+E +K Sbjct: 661 KAFAEYRARCPQADEPLYRDVPGSGGLVLSTMELEK 696 >ref|XP_004505520.1| PREDICTED: uncharacterized protein LOC101491060 [Cicer arietinum] Length = 763 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -1 Query: 221 RAFAEYRKRCPLPGEPLYKDVPGAGGFVSSTLERQK 114 +AFAEYR RCP EPLYKDVPG+GG V S +E +K Sbjct: 642 KAFAEYRARCPQADEPLYKDVPGSGGLVLSVMELEK 677