BLASTX nr result
ID: Paeonia23_contig00028204
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00028204 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515282.1| Cytochrome c oxidase polypeptide Vc, putativ... 80 3e-13 ref|XP_003579252.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 79 9e-13 ref|XP_007051107.1| Cytochrome c oxidase subunit 5C [Theobroma c... 79 9e-13 ref|XP_004300448.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 79 9e-13 ref|XP_002443358.1| hypothetical protein SORBIDRAFT_08g018180 [S... 78 1e-12 ref|XP_004962769.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 78 1e-12 ref|NP_001067021.1| Os12g0561000 [Oryza sativa Japonica Group] g... 77 2e-12 ref|XP_003535930.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 77 2e-12 ref|XP_003591400.1| Cytochrome c oxidase subunit 5C [Medicago tr... 77 2e-12 gb|ADB85086.1| cytochrome c oxidase polypeptide Vc [Jatropha cur... 77 2e-12 ref|XP_006402379.1| hypothetical protein EUTSA_v10006359mg [Eutr... 77 2e-12 ref|XP_003570359.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 77 2e-12 gb|ACG39497.1| cytochrome c oxidase polypeptide Vc [Zea mays] 77 3e-12 ref|XP_002320297.1| hypothetical protein POPTR_0014s11560g [Popu... 77 3e-12 ref|XP_004229388.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 76 4e-12 gb|AGE46018.1| cytochrome c oxidase subunit 5C [Elaeis guineensis] 76 4e-12 ref|XP_003562412.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 76 4e-12 ref|XP_006574529.1| PREDICTED: cytochrome c oxidase subunit 5C-2... 76 4e-12 gb|ACU15919.1| unknown [Glycine max] 76 4e-12 sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subun... 76 6e-12 >ref|XP_002515282.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] gi|255559374|ref|XP_002520707.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] gi|223540092|gb|EEF41669.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] gi|223545762|gb|EEF47266.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] Length = 63 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +3 Query: 6 LGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 LGL AGG+WKMHHWNEQRKVRAFYDLLEKGEISVVAEE Sbjct: 26 LGLAAGGLWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 63 >ref|XP_003579252.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Brachypodium distachyon] gi|357161935|ref|XP_003579253.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Brachypodium distachyon] gi|2493852|sp|Q42841.3|COX5C_HORVU RecName: Full=Cytochrome c oxidase subunit 5C; AltName: Full=Cytochrome c oxidase polypeptide Vc gi|1070356|emb|CAA92107.1| cytochrome c oxidase, Vc subunit [Hordeum vulgare subsp. vulgare] gi|473894931|gb|EMS48910.1| Cytochrome c oxidase subunit 5C [Triticum urartu] gi|475558729|gb|EMT13154.1| Cytochrome c oxidase subunit 5C [Aegilops tauschii] Length = 63 Score = 78.6 bits (192), Expect = 9e-13 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +3 Query: 3 TLGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 TLGL+AGGMWKMHHWNEQRK R+FYD+LEKG+ISVV EE Sbjct: 25 TLGLVAGGMWKMHHWNEQRKTRSFYDMLEKGQISVVVEE 63 >ref|XP_007051107.1| Cytochrome c oxidase subunit 5C [Theobroma cacao] gi|508703368|gb|EOX95264.1| Cytochrome c oxidase subunit 5C [Theobroma cacao] Length = 63 Score = 78.6 bits (192), Expect = 9e-13 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 3 TLGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 TLG AGG+WKMHHWNEQRKVRAFYD+LEKG+ISVVAEE Sbjct: 25 TLGFCAGGLWKMHHWNEQRKVRAFYDMLEKGDISVVAEE 63 >ref|XP_004300448.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Fragaria vesca subsp. vesca] Length = 63 Score = 78.6 bits (192), Expect = 9e-13 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +3 Query: 6 LGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 LGL AGG+WKMHHWNEQRKVR FYDLLEKGEISVVAEE Sbjct: 26 LGLAAGGLWKMHHWNEQRKVRTFYDLLEKGEISVVAEE 63 >ref|XP_002443358.1| hypothetical protein SORBIDRAFT_08g018180 [Sorghum bicolor] gi|241944051|gb|EES17196.1| hypothetical protein SORBIDRAFT_08g018180 [Sorghum bicolor] Length = 63 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +3 Query: 3 TLGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 TLGLIAGGMWKMHHWNEQRK R+FYD+L+KG+ISVV EE Sbjct: 25 TLGLIAGGMWKMHHWNEQRKTRSFYDMLDKGQISVVVEE 63 >ref|XP_004962769.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Setaria italica] gi|194693600|gb|ACF80884.1| unknown [Zea mays] gi|194705548|gb|ACF86858.1| unknown [Zea mays] gi|195605218|gb|ACG24439.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|195608682|gb|ACG26171.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|195610044|gb|ACG26852.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|195618014|gb|ACG30837.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|195655785|gb|ACG47360.1| cytochrome c oxidase polypeptide Vc [Zea mays] gi|414868438|tpg|DAA46995.1| TPA: cytochrome c oxidase polypeptide Vc [Zea mays] gi|414878119|tpg|DAA55250.1| TPA: cytochrome c oxidase polypeptide Vc [Zea mays] Length = 63 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +3 Query: 3 TLGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 TLGLIAGGMWKMHHWNEQRK R+FYD+L+KG+ISVV EE Sbjct: 25 TLGLIAGGMWKMHHWNEQRKTRSFYDMLDKGQISVVVEE 63 >ref|NP_001067021.1| Os12g0561000 [Oryza sativa Japonica Group] gi|48428177|sp|Q9SXX7.3|COX5C_ORYSJ RecName: Full=Cytochrome c oxidase subunit 5C; AltName: Full=Cytochrome c oxidase polypeptide Vc gi|4850330|dbj|BAA77682.1| cytochrome c oxidase subunit 5c [Oryza sativa Japonica Group] gi|113649528|dbj|BAF30040.1| Os12g0561000 [Oryza sativa Japonica Group] gi|125579724|gb|EAZ20870.1| hypothetical protein OsJ_36508 [Oryza sativa Japonica Group] Length = 63 Score = 77.4 bits (189), Expect = 2e-12 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +3 Query: 3 TLGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 TLGL+AGG+WKMHHWNEQRK R+FYD+LEKG+ISVV EE Sbjct: 25 TLGLVAGGLWKMHHWNEQRKTRSFYDMLEKGQISVVVEE 63 >ref|XP_003535930.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Glycine max] Length = 64 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +3 Query: 3 TLGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 TLGL AGG+WKMHHWNEQRK R FYDLLEKGEI+VVAEE Sbjct: 25 TLGLAAGGVWKMHHWNEQRKTRTFYDLLEKGEITVVAEE 63 >ref|XP_003591400.1| Cytochrome c oxidase subunit 5C [Medicago truncatula] gi|355480448|gb|AES61651.1| Cytochrome c oxidase subunit 5C [Medicago truncatula] Length = 64 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +3 Query: 3 TLGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 TLGL+AGG+WKMHHWNEQRK R FYDLLEKGEISVV +E Sbjct: 25 TLGLVAGGVWKMHHWNEQRKTRTFYDLLEKGEISVVVDE 63 >gb|ADB85086.1| cytochrome c oxidase polypeptide Vc [Jatropha curcas] Length = 63 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +3 Query: 6 LGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 LGL AGG+WKMHHWNEQRKVRAFYDLLEKGEISVV +E Sbjct: 26 LGLAAGGLWKMHHWNEQRKVRAFYDLLEKGEISVVVDE 63 >ref|XP_006402379.1| hypothetical protein EUTSA_v10006359mg [Eutrema salsugineum] gi|557103478|gb|ESQ43832.1| hypothetical protein EUTSA_v10006359mg [Eutrema salsugineum] Length = 64 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +3 Query: 3 TLGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 TLGL AGG+WKMHHWNEQRK RAFYDLLE+GEISVVA E Sbjct: 25 TLGLAAGGLWKMHHWNEQRKTRAFYDLLERGEISVVAAE 63 >ref|XP_003570359.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Brachypodium distachyon] gi|357137543|ref|XP_003570360.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Brachypodium distachyon] gi|357137545|ref|XP_003570361.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Brachypodium distachyon] Length = 63 Score = 77.0 bits (188), Expect = 2e-12 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +3 Query: 3 TLGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 TLGL+AGGMWKMHHWNEQRK R+FYD+LEKG+ISVV +E Sbjct: 25 TLGLVAGGMWKMHHWNEQRKTRSFYDMLEKGQISVVVKE 63 >gb|ACG39497.1| cytochrome c oxidase polypeptide Vc [Zea mays] Length = 77 Score = 76.6 bits (187), Expect = 3e-12 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +3 Query: 3 TLGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 TLGLIAGGMWKMHHWNEQRK R+FYD+L+KG+ISVV E+ Sbjct: 25 TLGLIAGGMWKMHHWNEQRKTRSFYDMLDKGQISVVVED 63 >ref|XP_002320297.1| hypothetical protein POPTR_0014s11560g [Populus trichocarpa] gi|566203789|ref|XP_006375433.1| hypothetical protein POPTR_0014s11560g [Populus trichocarpa] gi|566203792|ref|XP_006375434.1| hypothetical protein POPTR_0014s11560g [Populus trichocarpa] gi|118482127|gb|ABK92994.1| unknown [Populus trichocarpa] gi|118484242|gb|ABK94001.1| unknown [Populus trichocarpa] gi|118485668|gb|ABK94684.1| unknown [Populus trichocarpa] gi|118487717|gb|ABK95683.1| unknown [Populus trichocarpa] gi|118489690|gb|ABK96646.1| unknown [Populus trichocarpa x Populus deltoides] gi|222861070|gb|EEE98612.1| hypothetical protein POPTR_0014s11560g [Populus trichocarpa] gi|550323999|gb|ERP53230.1| hypothetical protein POPTR_0014s11560g [Populus trichocarpa] gi|550324000|gb|ERP53231.1| hypothetical protein POPTR_0014s11560g [Populus trichocarpa] Length = 63 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +3 Query: 6 LGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 LGL+AG +WKMHHWNEQRKVR+FYDLLEKGEISVV EE Sbjct: 26 LGLVAGSLWKMHHWNEQRKVRSFYDLLEKGEISVVVEE 63 >ref|XP_004229388.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like isoform 1 [Solanum lycopersicum] gi|460367052|ref|XP_004229389.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like isoform 2 [Solanum lycopersicum] gi|565364959|ref|XP_006349185.1| PREDICTED: cytochrome c oxidase subunit 5C-2-like [Solanum tuberosum] Length = 63 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +3 Query: 6 LGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 LGL AG +WKMHHWNEQRKVR+FYDLLEKGEIS+VAEE Sbjct: 26 LGLAAGSLWKMHHWNEQRKVRSFYDLLEKGEISIVAEE 63 >gb|AGE46018.1| cytochrome c oxidase subunit 5C [Elaeis guineensis] Length = 63 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +3 Query: 3 TLGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 TLGL AG +WKMHHWNEQRK RAFYD+LEKGEISVV EE Sbjct: 25 TLGLFAGSLWKMHHWNEQRKTRAFYDMLEKGEISVVVEE 63 >ref|XP_003562412.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Brachypodium distachyon] Length = 66 Score = 76.3 bits (186), Expect = 4e-12 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +3 Query: 3 TLGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 TLGL+AGGMWKMHHWNEQRK R+FYD+L+KG+ISVV +E Sbjct: 28 TLGLVAGGMWKMHHWNEQRKTRSFYDMLDKGQISVVVQE 66 >ref|XP_006574529.1| PREDICTED: cytochrome c oxidase subunit 5C-2 [Glycine max] Length = 64 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +3 Query: 3 TLGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 TLGL AG +WKMHHWNEQRK R FYDLLEKGEISVVAEE Sbjct: 25 TLGLAAGSVWKMHHWNEQRKTRTFYDLLEKGEISVVAEE 63 >gb|ACU15919.1| unknown [Glycine max] Length = 64 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +3 Query: 3 TLGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 TLGL AG +WKMHHWNEQRK R FYDLLEKGEISVVAEE Sbjct: 25 TLGLAAGSVWKMHHWNEQRKTRTFYDLLEKGEISVVAEE 63 >sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subunit 5C-2; AltName: Full=Cytochrome c oxidase polypeptide Vc-2 gi|18409602|gb|AAL67939.1| cytochrome c oxidase subunit 5c [Helianthus annuus] Length = 64 Score = 75.9 bits (185), Expect = 6e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +3 Query: 6 LGLIAGGMWKMHHWNEQRKVRAFYDLLEKGEISVVAEE 119 LGL AGG+WKMHHWNEQRK RAFYDLLEKGEISVV +E Sbjct: 26 LGLAAGGLWKMHHWNEQRKTRAFYDLLEKGEISVVVDE 63