BLASTX nr result
ID: Paeonia23_contig00028158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00028158 (452 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270174.1| PREDICTED: putative phosphatidylglycerol/pho... 69 5e-10 emb|CAN64691.1| hypothetical protein VITISV_030670 [Vitis vinifera] 69 5e-10 ref|NP_001236775.1| uncharacterized protein LOC100306050 precurs... 57 3e-06 ref|XP_007145775.1| hypothetical protein PHAVU_007G266700g [Phas... 55 1e-05 ref|XP_006424065.1| hypothetical protein CICLE_v10029501mg [Citr... 55 1e-05 >ref|XP_002270174.1| PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179 [Vitis vinifera] gi|296084851|emb|CBI28260.3| unnamed protein product [Vitis vinifera] Length = 154 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -2 Query: 448 PPGSYTLRMKMEDEKKQELTCITFNFNIRFGSYVSDN 338 PPGSYTL+MKMEDE K +LTCITFNFNI FGSYV+D+ Sbjct: 118 PPGSYTLKMKMEDESKHQLTCITFNFNIGFGSYVADS 154 >emb|CAN64691.1| hypothetical protein VITISV_030670 [Vitis vinifera] Length = 154 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -2 Query: 448 PPGSYTLRMKMEDEKKQELTCITFNFNIRFGSYVSDN 338 PPGSYTL+MKMEDE K +LTCITFNFNI FGSYV+D+ Sbjct: 118 PPGSYTLKMKMEDESKHQLTCITFNFNIGFGSYVADS 154 >ref|NP_001236775.1| uncharacterized protein LOC100306050 precursor [Glycine max] gi|255627393|gb|ACU14041.1| unknown [Glycine max] Length = 154 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -2 Query: 448 PPGSYTLRMKMEDEKKQELTCITFNFNIRFGSYVSDN 338 PPGSYTL+MKM D K ELTCITF F+I FGS V+D+ Sbjct: 118 PPGSYTLKMKMFDGNKHELTCITFGFDIGFGSSVADS 154 >ref|XP_007145775.1| hypothetical protein PHAVU_007G266700g [Phaseolus vulgaris] gi|561018965|gb|ESW17769.1| hypothetical protein PHAVU_007G266700g [Phaseolus vulgaris] Length = 153 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -2 Query: 448 PPGSYTLRMKMEDEKKQELTCITFNFNIRFGSYVSD 341 PPGSY+L+MKM D K ELTCITF F+I FGS V+D Sbjct: 117 PPGSYSLKMKMFDGNKHELTCITFGFDIGFGSSVAD 152 >ref|XP_006424065.1| hypothetical protein CICLE_v10029501mg [Citrus clementina] gi|568869246|ref|XP_006487839.1| PREDICTED: putative phosphatidylglycerol/phosphatidylinositol transfer protein DDB_G0282179-like [Citrus sinensis] gi|557525999|gb|ESR37305.1| hypothetical protein CICLE_v10029501mg [Citrus clementina] Length = 149 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -2 Query: 448 PPGSYTLRMKMEDEKKQELTCITFNFNIRFGSYVSDN 338 PPGSYTL+M MED+ +ELTC +FNF I F S VSD+ Sbjct: 113 PPGSYTLKMTMEDKNNEELTCFSFNFKIGFHSLVSDS 149