BLASTX nr result
ID: Paeonia23_contig00028127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00028127 (767 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI31317.3| unnamed protein product [Vitis vinifera] 59 2e-06 ref|XP_006371421.1| hypothetical protein POPTR_0019s10130g [Popu... 50 8e-06 ref|XP_002325509.2| hypothetical protein POPTR_0019s10130g [Popu... 50 8e-06 >emb|CBI31317.3| unnamed protein product [Vitis vinifera] Length = 390 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = +1 Query: 634 QIWLLPFTWGQHCSLGVAINFHYSISPPNRGIRH*LSRLQDVNS 765 QIWLLPFTW QHC LGV I+ HYS+ + +SRLQDVNS Sbjct: 345 QIWLLPFTWAQHCFLGVDIDNHYSLPSTEERYQALISRLQDVNS 388 >ref|XP_006371421.1| hypothetical protein POPTR_0019s10130g [Populus trichocarpa] gi|550317189|gb|ERP49218.1| hypothetical protein POPTR_0019s10130g [Populus trichocarpa] Length = 419 Score = 50.4 bits (119), Expect(2) = 8e-06 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = +1 Query: 634 QIWLLPFTWGQHCSLGVAINFHYSIS 711 QIWLLPF WGQHC GVAI+ HYS+S Sbjct: 378 QIWLLPFPWGQHCFFGVAIDSHYSLS 403 Score = 26.2 bits (56), Expect(2) = 8e-06 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +3 Query: 711 TTEQRYQALTLAIAG 755 +TE+RYQAL AIAG Sbjct: 404 STEERYQALNFAIAG 418 >ref|XP_002325509.2| hypothetical protein POPTR_0019s10130g [Populus trichocarpa] gi|550317188|gb|EEE99890.2| hypothetical protein POPTR_0019s10130g [Populus trichocarpa] Length = 391 Score = 50.4 bits (119), Expect(2) = 8e-06 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = +1 Query: 634 QIWLLPFTWGQHCSLGVAINFHYSIS 711 QIWLLPF WGQHC GVAI+ HYS+S Sbjct: 350 QIWLLPFPWGQHCFFGVAIDSHYSLS 375 Score = 26.2 bits (56), Expect(2) = 8e-06 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +3 Query: 711 TTEQRYQALTLAIAG 755 +TE+RYQAL AIAG Sbjct: 376 STEERYQALNFAIAG 390