BLASTX nr result
ID: Paeonia23_contig00027934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00027934 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007045472.1| Anthranilate synthase beta subunit 1 [Theobr... 80 3e-13 ref|XP_002878947.1| predicted protein [Arabidopsis lyrata subsp.... 80 3e-13 ref|XP_002876803.1| hypothetical protein ARALYDRAFT_484144 [Arab... 79 5e-13 ref|XP_002527548.1| Anthranilate synthase component II, putative... 79 8e-13 ref|XP_002312481.2| hypothetical protein POPTR_0008s13820g [Popu... 77 2e-12 ref|XP_004297400.1| PREDICTED: anthranilate synthase component I... 77 2e-12 ref|XP_003547656.1| PREDICTED: anthranilate synthase component 2... 77 2e-12 ref|XP_007222508.1| hypothetical protein PRUPE_ppa009800mg [Prun... 77 3e-12 ref|XP_002314761.1| anthranilate synthase beta subunit 1 family ... 77 3e-12 ref|XP_007153189.1| hypothetical protein PHAVU_003G014300g [Phas... 76 4e-12 ref|NP_200597.1| glutamine amidotransferase type 1 family protei... 76 5e-12 ref|XP_006304070.1| hypothetical protein CARUB_v10009928mg [Caps... 76 5e-12 ref|XP_002890696.1| hypothetical protein ARALYDRAFT_472860 [Arab... 76 5e-12 gb|AAM65944.1| anthranilate synthase beta chain [Arabidopsis tha... 76 5e-12 ref|XP_006469298.1| PREDICTED: anthranilate synthase component 2... 75 7e-12 ref|XP_006448093.1| hypothetical protein CICLE_v100161761mg, par... 75 7e-12 gb|ACJ84848.1| unknown [Medicago truncatula] gi|388498572|gb|AFK... 75 7e-12 ref|NP_173893.1| anthranilate synthase beta subunit 1 [Arabidops... 75 9e-12 ref|NP_001185092.1| anthranilate synthase beta subunit 1 [Arabid... 75 9e-12 ref|XP_006415834.1| hypothetical protein EUTSA_v10008447mg [Eutr... 75 1e-11 >ref|XP_007045472.1| Anthranilate synthase beta subunit 1 [Theobroma cacao] gi|508709407|gb|EOY01304.1| Anthranilate synthase beta subunit 1 [Theobroma cacao] Length = 280 Score = 80.1 bits (196), Expect = 3e-13 Identities = 40/45 (88%), Positives = 41/45 (91%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADESK 180 AARHK YKHLQGVQFHPESIITSEGK IV NFVKLIEKKEA ES+ Sbjct: 235 AARHKVYKHLQGVQFHPESIITSEGKTIVRNFVKLIEKKEAAESQ 279 >ref|XP_002878947.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297324786|gb|EFH55206.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 275 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/43 (81%), Positives = 42/43 (97%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 186 AARHKKYKH+QGVQFHPESIIT+EGK IVGNF+KL+EKKE+++ Sbjct: 231 AARHKKYKHIQGVQFHPESIITTEGKTIVGNFIKLVEKKESEK 273 >ref|XP_002876803.1| hypothetical protein ARALYDRAFT_484144 [Arabidopsis lyrata subsp. lyrata] gi|297322641|gb|EFH53062.1| hypothetical protein ARALYDRAFT_484144 [Arabidopsis lyrata subsp. lyrata] Length = 276 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/43 (81%), Positives = 42/43 (97%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 186 AARH+KYKH+QGVQFHPESIIT+EGK IVGNF+KLIEKKE+++ Sbjct: 232 AARHRKYKHIQGVQFHPESIITTEGKTIVGNFIKLIEKKESEK 274 >ref|XP_002527548.1| Anthranilate synthase component II, putative [Ricinus communis] gi|223533098|gb|EEF34857.1| Anthranilate synthase component II, putative [Ricinus communis] Length = 281 Score = 78.6 bits (192), Expect = 8e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEAD 189 AARHKKYKHLQGVQFHPESIITSEGK IV NF+KL+E+KEA+ Sbjct: 237 AARHKKYKHLQGVQFHPESIITSEGKTIVQNFIKLVERKEAE 278 >ref|XP_002312481.2| hypothetical protein POPTR_0008s13820g [Populus trichocarpa] gi|550333014|gb|EEE89848.2| hypothetical protein POPTR_0008s13820g [Populus trichocarpa] Length = 278 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEAD 189 AARH+KYKHLQGVQFHPESIITSEGK IV NF+K+IE+KEA+ Sbjct: 234 AARHRKYKHLQGVQFHPESIITSEGKIIVSNFIKMIERKEAE 275 >ref|XP_004297400.1| PREDICTED: anthranilate synthase component II-like [Fragaria vesca subsp. vesca] Length = 277 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEAD 189 AARHKKYK+LQGVQFHPESIITSEG+ IVGNFVKLIEK E++ Sbjct: 233 AARHKKYKYLQGVQFHPESIITSEGRTIVGNFVKLIEKSESE 274 >ref|XP_003547656.1| PREDICTED: anthranilate synthase component 2-like isoform 1 [Glycine max] Length = 278 Score = 77.0 bits (188), Expect = 2e-12 Identities = 38/44 (86%), Positives = 39/44 (88%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADES 183 AARHKKYKHLQGVQFHPESIIT EGK IV NFVKLIEK+EA S Sbjct: 235 AARHKKYKHLQGVQFHPESIITPEGKTIVRNFVKLIEKREAGGS 278 >ref|XP_007222508.1| hypothetical protein PRUPE_ppa009800mg [Prunus persica] gi|462419444|gb|EMJ23707.1| hypothetical protein PRUPE_ppa009800mg [Prunus persica] Length = 277 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEAD 189 AARHKKY+HLQGVQFHPESIITSEGK IV NF+KLIEK+E++ Sbjct: 233 AARHKKYRHLQGVQFHPESIITSEGKTIVRNFIKLIEKRESE 274 >ref|XP_002314761.1| anthranilate synthase beta subunit 1 family protein [Populus trichocarpa] gi|222863801|gb|EEF00932.1| anthranilate synthase beta subunit 1 family protein [Populus trichocarpa] Length = 276 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/42 (80%), Positives = 40/42 (95%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEAD 189 AARH+KYKHLQGVQFHPESIITSEGK IV NF+K++E+KEA+ Sbjct: 232 AARHRKYKHLQGVQFHPESIITSEGKTIVRNFIKMVERKEAE 273 >ref|XP_007153189.1| hypothetical protein PHAVU_003G014300g [Phaseolus vulgaris] gi|561026543|gb|ESW25183.1| hypothetical protein PHAVU_003G014300g [Phaseolus vulgaris] Length = 277 Score = 76.3 bits (186), Expect = 4e-12 Identities = 38/44 (86%), Positives = 38/44 (86%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADES 183 AARHKKYKHLQGVQFHPESIIT EGK IV NFVKLIEK EA S Sbjct: 234 AARHKKYKHLQGVQFHPESIITPEGKKIVQNFVKLIEKMEAGGS 277 >ref|NP_200597.1| glutamine amidotransferase type 1 family protein [Arabidopsis thaliana] gi|75171068|sp|Q9FJM5.1|ASB2_ARATH RecName: Full=Anthranilate synthase beta subunit 2, chloroplastic; AltName: Full=Anthranilate synthase component 2-2; AltName: Full=Anthranilate synthase, glutamine amidotransferase component 2-2; Flags: Precursor gi|9758358|dbj|BAB08859.1| anthranilate synthase beta chain [Arabidopsis thaliana] gi|90186236|gb|ABD91494.1| At5g57890 [Arabidopsis thaliana] gi|332009585|gb|AED96968.1| glutamine amidotransferase type 1 family protein [Arabidopsis thaliana] Length = 273 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/43 (76%), Positives = 41/43 (95%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 186 AARH+KYKH+QGVQFHPESIIT+EGK IV NF+KL+EKKE+++ Sbjct: 229 AARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESEK 271 >ref|XP_006304070.1| hypothetical protein CARUB_v10009928mg [Capsella rubella] gi|482572781|gb|EOA36968.1| hypothetical protein CARUB_v10009928mg [Capsella rubella] Length = 286 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/43 (76%), Positives = 41/43 (95%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 186 AARH+KYKH+QGVQFHPESIIT+EGK IV NF+KL+EKKE+++ Sbjct: 242 AARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESEK 284 >ref|XP_002890696.1| hypothetical protein ARALYDRAFT_472860 [Arabidopsis lyrata subsp. lyrata] gi|297336538|gb|EFH66955.1| hypothetical protein ARALYDRAFT_472860 [Arabidopsis lyrata subsp. lyrata] Length = 277 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/43 (76%), Positives = 41/43 (95%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 186 AARH+KYKH+QGVQFHPESIIT+EGK IV NF+KL+EKKE+++ Sbjct: 233 AARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESEK 275 >gb|AAM65944.1| anthranilate synthase beta chain [Arabidopsis thaliana] Length = 273 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/43 (76%), Positives = 41/43 (95%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 186 AARH+KYKH+QGVQFHPESIIT+EGK IV NF+KL+EKKE+++ Sbjct: 229 AARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESEK 271 >ref|XP_006469298.1| PREDICTED: anthranilate synthase component 2-like [Citrus sinensis] Length = 283 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADESK 180 AARHKKYKHLQGVQFHPESIIT+EGK IV NF+K+I +KEA +S+ Sbjct: 238 AARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAADSQ 282 >ref|XP_006448093.1| hypothetical protein CICLE_v100161761mg, partial [Citrus clementina] gi|557550704|gb|ESR61333.1| hypothetical protein CICLE_v100161761mg, partial [Citrus clementina] Length = 80 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADESK 180 AARHKKYKHLQGVQFHPESIIT+EGK IV NF+K+I +KEA +S+ Sbjct: 35 AARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAADSQ 79 >gb|ACJ84848.1| unknown [Medicago truncatula] gi|388498572|gb|AFK37352.1| unknown [Medicago truncatula] Length = 270 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADES 183 AARHKKY+H+QGVQFHPESIIT +GK IV NFVKLIEKKEA S Sbjct: 227 AARHKKYRHMQGVQFHPESIITPDGKTIVHNFVKLIEKKEAARS 270 >ref|NP_173893.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] gi|75102739|sp|Q42565.1|ASB1_ARATH RecName: Full=Anthranilate synthase beta subunit 1, chloroplastic; AltName: Full=Anthranilate synthase component 2-1; AltName: Full=Anthranilate synthase, glutamine amidotransferase component 2-1; AltName: Full=Protein TRYPTOPHAN BIOSYNTHESIS 4; AltName: Full=Protein WEAK ETHYLENE INSENSITIVE 7; Flags: Precursor gi|11067285|gb|AAG28813.1|AC079374_16 anthranilate synthase beta subunit [Arabidopsis thaliana] gi|403434|gb|AAA32742.1| anthranilate synthase beta subunit [Arabidopsis thaliana] gi|20466736|gb|AAM20685.1| anthranilate synthase beta subunit [Arabidopsis thaliana] gi|30023756|gb|AAP13411.1| At1g25220 [Arabidopsis thaliana] gi|110741096|dbj|BAE98642.1| hypothetical protein [Arabidopsis thaliana] gi|332192468|gb|AEE30589.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] Length = 276 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/43 (74%), Positives = 41/43 (95%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 186 AARH+KYKH+QGVQFHPESIIT+EGK IV NF+K++EKKE+++ Sbjct: 232 AARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKIVEKKESEK 274 >ref|NP_001185092.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] gi|332192469|gb|AEE30590.1| anthranilate synthase beta subunit 1 [Arabidopsis thaliana] Length = 289 Score = 75.1 bits (183), Expect = 9e-12 Identities = 32/43 (74%), Positives = 41/43 (95%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEADE 186 AARH+KYKH+QGVQFHPESIIT+EGK IV NF+K++EKKE+++ Sbjct: 245 AARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKIVEKKESEK 287 >ref|XP_006415834.1| hypothetical protein EUTSA_v10008447mg [Eutrema salsugineum] gi|557093605|gb|ESQ34187.1| hypothetical protein EUTSA_v10008447mg [Eutrema salsugineum] Length = 275 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = -1 Query: 314 AARHKKYKHLQGVQFHPESIITSEGKHIVGNFVKLIEKKEAD 189 AARH+K+KH+QGVQFHPESIIT+EGK IV NF+KL+EKKEA+ Sbjct: 231 AARHRKHKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKEAE 272