BLASTX nr result
ID: Paeonia23_contig00027751
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00027751 (355 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301051.1| hypothetical protein POPTR_0002s09670g [Popu... 47 6e-08 ref|XP_002513916.1| conserved hypothetical protein [Ricinus comm... 44 1e-06 ref|XP_007018781.1| Retrotransposon-derived protein PEG10, putat... 39 4e-06 >ref|XP_002301051.1| hypothetical protein POPTR_0002s09670g [Populus trichocarpa] gi|222842777|gb|EEE80324.1| hypothetical protein POPTR_0002s09670g [Populus trichocarpa] Length = 105 Score = 47.4 bits (111), Expect(2) = 6e-08 Identities = 20/28 (71%), Positives = 27/28 (96%) Frame = +3 Query: 159 VGDLKIELVRERMKSKRIEICGLVEVML 242 +GDLK+EL RER+KSKRI++CGL+EV+L Sbjct: 58 IGDLKMELARERLKSKRIKLCGLMEVIL 85 Score = 35.0 bits (79), Expect(2) = 6e-08 Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = +2 Query: 11 ERNDEVLKSQVAIRCAKATLFI*SLKSV-GSHTSRSAEQYEDE 136 E D+ LKSQVA+RCAKA + + LKS H + S + +E Sbjct: 8 ESKDKPLKSQVAVRCAKAAILLSLLKSFPNRHFTTSIDDQREE 50 >ref|XP_002513916.1| conserved hypothetical protein [Ricinus communis] gi|223547002|gb|EEF48499.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 43.9 bits (102), Expect(2) = 1e-06 Identities = 18/30 (60%), Positives = 27/30 (90%) Frame = +3 Query: 153 ESVGDLKIELVRERMKSKRIEICGLVEVML 242 + +GDLK++L RER K+KRI++CGL+EV+L Sbjct: 50 KQIGDLKMKLARERTKNKRIKLCGLMEVIL 79 Score = 34.3 bits (77), Expect(2) = 1e-06 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +2 Query: 11 ERNDEVLKSQVAIRCAKATLFI*SLKSVGSHTSRSAEQYEDE 136 E DE +S++ RCAKA + SLKS + S+++ EDE Sbjct: 2 EMTDEAARSEITRRCAKAAFLLHSLKSSPNRHSKTSINGEDE 43 >ref|XP_007018781.1| Retrotransposon-derived protein PEG10, putative [Theobroma cacao] gi|508724109|gb|EOY16006.1| Retrotransposon-derived protein PEG10, putative [Theobroma cacao] Length = 113 Score = 38.5 bits (88), Expect(2) = 4e-06 Identities = 21/45 (46%), Positives = 27/45 (60%) Frame = +2 Query: 2 VESERNDEVLKSQVAIRCAKATLFI*SLKSVGSHTSRSAEQYEDE 136 +E++ DE K +AIRCAKA L + SLKS S +A EDE Sbjct: 4 IEAKTRDEAPKLLMAIRCAKAALLLSSLKSSVSRVFEAANNDEDE 48 Score = 37.7 bits (86), Expect(2) = 4e-06 Identities = 14/30 (46%), Positives = 27/30 (90%) Frame = +3 Query: 159 VGDLKIELVRERMKSKRIEICGLVEVMLTL 248 + +L++ELV+ER+K K+I++CG++E++L L Sbjct: 57 IENLRVELVKERLKIKKIKLCGVMELILQL 86