BLASTX nr result
ID: Paeonia23_contig00027671
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00027671 (246 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007208451.1| hypothetical protein PRUPE_ppa003647mg [Prun... 56 6e-06 >ref|XP_007208451.1| hypothetical protein PRUPE_ppa003647mg [Prunus persica] gi|462404093|gb|EMJ09650.1| hypothetical protein PRUPE_ppa003647mg [Prunus persica] Length = 559 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/45 (64%), Positives = 31/45 (68%) Frame = -2 Query: 137 FGKGHPFCWRLVKGHGIAVGLTSLGDMGNSVVDHYAHGAG*IFAQ 3 F KG P WRLV+ HG AVGL + DMGNS V H A GAG IFAQ Sbjct: 52 FKKGAPERWRLVRAHGTAVGLPTEDDMGNSEVGHNALGAGRIFAQ 96