BLASTX nr result
ID: Paeonia23_contig00027068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00027068 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007023237.1| Cyclin F-box [Theobroma cacao] gi|508778603|... 55 8e-06 >ref|XP_007023237.1| Cyclin F-box [Theobroma cacao] gi|508778603|gb|EOY25859.1| Cyclin F-box [Theobroma cacao] Length = 971 Score = 55.5 bits (132), Expect = 8e-06 Identities = 20/32 (62%), Positives = 28/32 (87%) Frame = -2 Query: 270 GRQVKIKGYDEWWNALEWEDEATRIAFLPTFR 175 G+Q+ I+GY+EWW L+W+DEATR AFLP+F+ Sbjct: 401 GKQISIEGYEEWWEELQWKDEATRNAFLPSFK 432