BLASTX nr result
ID: Paeonia23_contig00027013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00027013 (294 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007222508.1| hypothetical protein PRUPE_ppa009800mg [Prun... 82 6e-14 ref|XP_002314761.1| anthranilate synthase beta subunit 1 family ... 82 6e-14 ref|XP_002527548.1| Anthranilate synthase component II, putative... 82 1e-13 gb|EXC05041.1| hypothetical protein L484_019289 [Morus notabilis] 80 4e-13 ref|XP_004297400.1| PREDICTED: anthranilate synthase component I... 79 7e-13 ref|XP_002312481.2| hypothetical protein POPTR_0008s13820g [Popu... 78 1e-12 ref|XP_007045472.1| Anthranilate synthase beta subunit 1 [Theobr... 75 7e-12 ref|XP_004251759.1| PREDICTED: anthranilate synthase component I... 74 2e-11 gb|EYU30159.1| hypothetical protein MIMGU_mgv1a0115071mg, partia... 73 4e-11 ref|NP_200597.1| glutamine amidotransferase type 1 family protei... 73 4e-11 ref|XP_006469298.1| PREDICTED: anthranilate synthase component 2... 73 4e-11 ref|XP_006448093.1| hypothetical protein CICLE_v100161761mg, par... 73 4e-11 ref|XP_004513238.1| PREDICTED: anthranilate synthase component I... 73 4e-11 ref|XP_006304070.1| hypothetical protein CARUB_v10009928mg [Caps... 73 4e-11 ref|XP_003547656.1| PREDICTED: anthranilate synthase component 2... 73 4e-11 ref|XP_002890696.1| hypothetical protein ARALYDRAFT_472860 [Arab... 73 4e-11 gb|AAM65944.1| anthranilate synthase beta chain [Arabidopsis tha... 73 4e-11 ref|XP_006415834.1| hypothetical protein EUTSA_v10008447mg [Eutr... 73 5e-11 ref|XP_004142292.1| PREDICTED: anthranilate synthase component I... 73 5e-11 emb|CBI26786.3| unnamed protein product [Vitis vinifera] 73 5e-11 >ref|XP_007222508.1| hypothetical protein PRUPE_ppa009800mg [Prunus persica] gi|462419444|gb|EMJ23707.1| hypothetical protein PRUPE_ppa009800mg [Prunus persica] Length = 277 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERKEAESEN 160 AARHKKYR+L GVQFHPESIITSEGK IVRNF+KLIE++E+ESEN Sbjct: 233 AARHKKYRHLQGVQFHPESIITSEGKTIVRNFIKLIEKRESESEN 277 >ref|XP_002314761.1| anthranilate synthase beta subunit 1 family protein [Populus trichocarpa] gi|222863801|gb|EEF00932.1| anthranilate synthase beta subunit 1 family protein [Populus trichocarpa] Length = 276 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/45 (82%), Positives = 43/45 (95%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERKEAESEN 160 AARH+KY++L GVQFHPESIITSEGK IVRNF+K++ERKEAESEN Sbjct: 232 AARHRKYKHLQGVQFHPESIITSEGKTIVRNFIKMVERKEAESEN 276 >ref|XP_002527548.1| Anthranilate synthase component II, putative [Ricinus communis] gi|223533098|gb|EEF34857.1| Anthranilate synthase component II, putative [Ricinus communis] Length = 281 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/45 (82%), Positives = 43/45 (95%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERKEAESEN 160 AARHKKY++L GVQFHPESIITSEGK IV+NF+KL+ERKEAES+N Sbjct: 237 AARHKKYKHLQGVQFHPESIITSEGKTIVQNFIKLVERKEAESQN 281 >gb|EXC05041.1| hypothetical protein L484_019289 [Morus notabilis] Length = 273 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/45 (77%), Positives = 43/45 (95%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERKEAESEN 160 AARHKKYRYL GVQFHPESIIT+EGK +VRNF+K+IER+E+E++N Sbjct: 229 AARHKKYRYLQGVQFHPESIITTEGKGMVRNFIKMIERRESETQN 273 >ref|XP_004297400.1| PREDICTED: anthranilate synthase component II-like [Fragaria vesca subsp. vesca] Length = 277 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERKEAESEN 160 AARHKKY+YL GVQFHPESIITSEG+ IV NFVKLIE+ E+ESEN Sbjct: 233 AARHKKYKYLQGVQFHPESIITSEGRTIVGNFVKLIEKSESESEN 277 >ref|XP_002312481.2| hypothetical protein POPTR_0008s13820g [Populus trichocarpa] gi|550333014|gb|EEE89848.2| hypothetical protein POPTR_0008s13820g [Populus trichocarpa] Length = 278 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERKEAESEN 160 AARH+KY++L GVQFHPESIITSEGK IV NF+K+IERKEAESE+ Sbjct: 234 AARHRKYKHLQGVQFHPESIITSEGKIIVSNFIKMIERKEAESES 278 >ref|XP_007045472.1| Anthranilate synthase beta subunit 1 [Theobroma cacao] gi|508709407|gb|EOY01304.1| Anthranilate synthase beta subunit 1 [Theobroma cacao] Length = 280 Score = 75.5 bits (184), Expect = 7e-12 Identities = 38/46 (82%), Positives = 42/46 (91%), Gaps = 1/46 (2%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERKE-AESEN 160 AARHK Y++L GVQFHPESIITSEGK IVRNFVKLIE+KE AES+N Sbjct: 235 AARHKVYKHLQGVQFHPESIITSEGKTIVRNFVKLIEKKEAAESQN 280 >ref|XP_004251759.1| PREDICTED: anthranilate synthase component II-like [Solanum lycopersicum] Length = 283 Score = 73.9 bits (180), Expect = 2e-11 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 1/46 (2%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERK-EAESEN 160 AARHK YR++ GVQFHPESIITSEGK IV NF+KLIERK EAES+N Sbjct: 238 AARHKVYRHIQGVQFHPESIITSEGKTIVYNFIKLIERKEEAESQN 283 >gb|EYU30159.1| hypothetical protein MIMGU_mgv1a0115071mg, partial [Mimulus guttatus] Length = 80 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERKEAES 166 AARHK +R+L GVQFHPESIITSEG+ IV+NF+KLIERKEAES Sbjct: 35 AARHKVHRHLLGVQFHPESIITSEGRTIVQNFIKLIERKEAES 77 >ref|NP_200597.1| glutamine amidotransferase type 1 family protein [Arabidopsis thaliana] gi|75171068|sp|Q9FJM5.1|ASB2_ARATH RecName: Full=Anthranilate synthase beta subunit 2, chloroplastic; AltName: Full=Anthranilate synthase component 2-2; AltName: Full=Anthranilate synthase, glutamine amidotransferase component 2-2; Flags: Precursor gi|9758358|dbj|BAB08859.1| anthranilate synthase beta chain [Arabidopsis thaliana] gi|90186236|gb|ABD91494.1| At5g57890 [Arabidopsis thaliana] gi|332009585|gb|AED96968.1| glutamine amidotransferase type 1 family protein [Arabidopsis thaliana] Length = 273 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/42 (73%), Positives = 40/42 (95%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERKEAE 169 AARH+KY+++ GVQFHPESIIT+EGK IVRNF+KL+E+KE+E Sbjct: 229 AARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESE 270 >ref|XP_006469298.1| PREDICTED: anthranilate synthase component 2-like [Citrus sinensis] Length = 283 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/46 (76%), Positives = 42/46 (91%), Gaps = 1/46 (2%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERKE-AESEN 160 AARHKKY++L GVQFHPESIIT+EGK IVRNF+K+I RKE A+S+N Sbjct: 238 AARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAADSQN 283 >ref|XP_006448093.1| hypothetical protein CICLE_v100161761mg, partial [Citrus clementina] gi|557550704|gb|ESR61333.1| hypothetical protein CICLE_v100161761mg, partial [Citrus clementina] Length = 80 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/46 (76%), Positives = 42/46 (91%), Gaps = 1/46 (2%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERKE-AESEN 160 AARHKKY++L GVQFHPESIIT+EGK IVRNF+K+I RKE A+S+N Sbjct: 35 AARHKKYKHLQGVQFHPESIITTEGKTIVRNFIKMIVRKEAADSQN 80 >ref|XP_004513238.1| PREDICTED: anthranilate synthase component II-like [Cicer arietinum] Length = 273 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERKEAES 166 AARHKKYRYL GVQFHPESIIT EG IV NFVKLIE++EA S Sbjct: 230 AARHKKYRYLQGVQFHPESIITPEGMTIVHNFVKLIEKREAAS 272 >ref|XP_006304070.1| hypothetical protein CARUB_v10009928mg [Capsella rubella] gi|482572781|gb|EOA36968.1| hypothetical protein CARUB_v10009928mg [Capsella rubella] Length = 286 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/42 (73%), Positives = 40/42 (95%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERKEAE 169 AARH+KY+++ GVQFHPESIIT+EGK IVRNF+KL+E+KE+E Sbjct: 242 AARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESE 283 >ref|XP_003547656.1| PREDICTED: anthranilate synthase component 2-like isoform 1 [Glycine max] Length = 278 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERKEA 172 AARHKKY++L GVQFHPESIIT EGK IVRNFVKLIE++EA Sbjct: 235 AARHKKYKHLQGVQFHPESIITPEGKTIVRNFVKLIEKREA 275 >ref|XP_002890696.1| hypothetical protein ARALYDRAFT_472860 [Arabidopsis lyrata subsp. lyrata] gi|297336538|gb|EFH66955.1| hypothetical protein ARALYDRAFT_472860 [Arabidopsis lyrata subsp. lyrata] Length = 277 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/42 (73%), Positives = 40/42 (95%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERKEAE 169 AARH+KY+++ GVQFHPESIIT+EGK IVRNF+KL+E+KE+E Sbjct: 233 AARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESE 274 >gb|AAM65944.1| anthranilate synthase beta chain [Arabidopsis thaliana] Length = 273 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/42 (73%), Positives = 40/42 (95%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERKEAE 169 AARH+KY+++ GVQFHPESIIT+EGK IVRNF+KL+E+KE+E Sbjct: 229 AARHRKYKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKESE 270 >ref|XP_006415834.1| hypothetical protein EUTSA_v10008447mg [Eutrema salsugineum] gi|557093605|gb|ESQ34187.1| hypothetical protein EUTSA_v10008447mg [Eutrema salsugineum] Length = 275 Score = 72.8 bits (177), Expect = 5e-11 Identities = 31/43 (72%), Positives = 41/43 (95%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERKEAES 166 AARH+K++++ GVQFHPESIIT+EGK IVRNF+KL+E+KEAE+ Sbjct: 231 AARHRKHKHIQGVQFHPESIITTEGKTIVRNFIKLVEKKEAEN 273 >ref|XP_004142292.1| PREDICTED: anthranilate synthase component II-like [Cucumis sativus] gi|449513110|ref|XP_004164233.1| PREDICTED: anthranilate synthase component II-like [Cucumis sativus] Length = 276 Score = 72.8 bits (177), Expect = 5e-11 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERKEAESE 163 AARH KYR+L GVQFHPESIIT+EG IVRNFVKLIE+KE E E Sbjct: 230 AARHSKYRHLQGVQFHPESIITNEGMLIVRNFVKLIEKKEREVE 273 >emb|CBI26786.3| unnamed protein product [Vitis vinifera] Length = 273 Score = 72.8 bits (177), Expect = 5e-11 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = -1 Query: 294 AARHKKYRYLHGVQFHPESIITSEGKQIVRNFVKLIERKEAESEN 160 AARHKKY++L GVQFHPESIITSEG+ IVRNFV++IER E++ N Sbjct: 229 AARHKKYKHLQGVQFHPESIITSEGRGIVRNFVRMIERSESKYHN 273