BLASTX nr result
ID: Paeonia23_contig00026678
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00026678 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007034371.1| Lectin-domain containing receptor kinase A4.... 64 2e-08 ref|XP_006420905.1| hypothetical protein CICLE_v10004317mg [Citr... 58 2e-06 ref|XP_006493814.1| PREDICTED: receptor like protein kinase S.2-... 56 6e-06 >ref|XP_007034371.1| Lectin-domain containing receptor kinase A4.3 [Theobroma cacao] gi|508713400|gb|EOY05297.1| Lectin-domain containing receptor kinase A4.3 [Theobroma cacao] Length = 830 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/73 (42%), Positives = 43/73 (58%), Gaps = 7/73 (9%) Frame = +3 Query: 111 MKLTRICFILPKEIDEVEFHNEIPHDSPIKKQ---RPHRVCANHLLTF----LRDFWDSK 269 M++ R+CFILP + DE+ + D P K+ P+R C + +L F LR F+DSK Sbjct: 1 MQINRLCFILPADFDEIAPLDHTKSDKPAMKEVKKHPYRECGSQILDFIGGALRRFYDSK 60 Query: 270 WTSFCHGNVPKKQ 308 W FCH +VP KQ Sbjct: 61 WVHFCHHDVPSKQ 73 >ref|XP_006420905.1| hypothetical protein CICLE_v10004317mg [Citrus clementina] gi|557522778|gb|ESR34145.1| hypothetical protein CICLE_v10004317mg [Citrus clementina] Length = 834 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 10/75 (13%) Frame = +3 Query: 114 KLTRICFILPKEIDEVE------FHNEIPHDSPIKKQRPHRVCANHLLTFLRD----FWD 263 +L R+CFILP ++DE+E HN + +K+Q R C +L+F+ D ++ Sbjct: 3 QLNRLCFILPADVDEIEPYEKSRVHNVVSRKQEVKEQHG-RGCGGRILSFIADKLQRLYE 61 Query: 264 SKWTSFCHGNVPKKQ 308 +KW FCH N P+K+ Sbjct: 62 AKWVCFCHHNTPRKE 76 >ref|XP_006493814.1| PREDICTED: receptor like protein kinase S.2-like [Citrus sinensis] Length = 834 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/75 (34%), Positives = 42/75 (56%), Gaps = 10/75 (13%) Frame = +3 Query: 114 KLTRICFILPKEIDEV------EFHNEIPHDSPIKKQRPHRVCANHLLTFLRD----FWD 263 +L R+CFILP ++DE+ HN + +K+Q R C +L+F+ D ++ Sbjct: 3 QLNRLCFILPADVDEIGPYEKSRVHNVVSRKQEVKEQHG-RGCGGRILSFIADKLQRLYE 61 Query: 264 SKWTSFCHGNVPKKQ 308 +KW FCH N P+K+ Sbjct: 62 AKWVCFCHHNTPRKE 76