BLASTX nr result
ID: Paeonia23_contig00025082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00025082 (420 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007208408.1| hypothetical protein PRUPE_ppa000008mg [Prun... 47 3e-06 ref|XP_004295182.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-... 46 6e-06 gb|EXB36051.1| E3 ubiquitin-protein ligase UPL1 [Morus notabilis] 48 1e-05 >ref|XP_007208408.1| hypothetical protein PRUPE_ppa000008mg [Prunus persica] gi|462404050|gb|EMJ09607.1| hypothetical protein PRUPE_ppa000008mg [Prunus persica] Length = 3766 Score = 47.4 bits (111), Expect(2) = 3e-06 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = +2 Query: 53 SGSFDVAHSYMIDVCVLPFNNLPSSLFGDWL 145 SGSFDVAH YM D VLP++++PS+LFGD L Sbjct: 2337 SGSFDVAHFYMFDAPVLPYDHVPSNLFGDRL 2367 Score = 29.3 bits (64), Expect(2) = 3e-06 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = +1 Query: 1 LVSMWSSGGNSVSELES 51 LVSMWS+GGNS +LE+ Sbjct: 2318 LVSMWSAGGNSSRDLEA 2334 >ref|XP_004295182.1| PREDICTED: E3 ubiquitin-protein ligase UPL1-like [Fragaria vesca subsp. vesca] Length = 3694 Score = 46.2 bits (108), Expect(2) = 6e-06 Identities = 20/31 (64%), Positives = 26/31 (83%) Frame = +2 Query: 53 SGSFDVAHSYMIDVCVLPFNNLPSSLFGDWL 145 SGSFDVAH YM D VLP++++P++LFGD L Sbjct: 2264 SGSFDVAHFYMFDAPVLPYDHVPNNLFGDRL 2294 Score = 29.3 bits (64), Expect(2) = 6e-06 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = +1 Query: 1 LVSMWSSGGNSVSELES 51 LVSMWS+GGNS +LE+ Sbjct: 2245 LVSMWSAGGNSSRDLEA 2261 >gb|EXB36051.1| E3 ubiquitin-protein ligase UPL1 [Morus notabilis] Length = 3733 Score = 47.8 bits (112), Expect(2) = 1e-05 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = +2 Query: 53 SGSFDVAHSYMIDVCVLPFNNLPSSLFGDWL 145 SGSFDVAH YM D VLP+++ PSSLFGD L Sbjct: 2333 SGSFDVAHFYMFDAPVLPYDHAPSSLFGDRL 2363 Score = 26.9 bits (58), Expect(2) = 1e-05 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +1 Query: 1 LVSMWSSGGNSVSELES 51 LVSMWSS GN+ +LE+ Sbjct: 2314 LVSMWSSSGNASRDLEA 2330