BLASTX nr result
ID: Paeonia23_contig00024877
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00024877 (253 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588264.1| hypothetical protein MTR_1g005050 [Medicago ... 79 5e-13 gb|AGC78957.1| hypothetical protein (mitochondrion) [Vicia faba] 78 1e-12 ref|XP_006401947.1| hypothetical protein EUTSA_v10015949mg, part... 60 3e-09 >ref|XP_003588264.1| hypothetical protein MTR_1g005050 [Medicago truncatula] gi|355477312|gb|AES58515.1| hypothetical protein MTR_1g005050 [Medicago truncatula] Length = 334 Score = 79.3 bits (194), Expect = 5e-13 Identities = 38/54 (70%), Positives = 39/54 (72%) Frame = -2 Query: 225 WPTPPKSAYVIWELMAKRRLMVLISGRNNKNQSPGWLVSLVIGDYLAWFGEHLL 64 WP+PPKSAYVIWELM NQSPGWLVSLVIGDYLAWFGEHLL Sbjct: 276 WPSPPKSAYVIWELM---------------NQSPGWLVSLVIGDYLAWFGEHLL 314 >gb|AGC78957.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 106 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/55 (67%), Positives = 42/55 (76%) Frame = -2 Query: 225 WPTPPKSAYVIWELMAKRRLMVLISGRNNKNQSPGWLVSLVIGDYLAWFGEHLLG 61 WPT + + + LMVLISGRNN+N+SPGWLVSLVIGDYLAWFGEHLLG Sbjct: 52 WPTQERLCNMGTHGWKQSFLMVLISGRNNQNKSPGWLVSLVIGDYLAWFGEHLLG 106 >ref|XP_006401947.1| hypothetical protein EUTSA_v10015949mg, partial [Eutrema salsugineum] gi|557103037|gb|ESQ43400.1| hypothetical protein EUTSA_v10015949mg, partial [Eutrema salsugineum] Length = 251 Score = 59.7 bits (143), Expect(2) = 3e-09 Identities = 37/56 (66%), Positives = 37/56 (66%) Frame = -2 Query: 168 LMVLISGRNNKNQSPGWLVSLVIGDYLAWFGEHLLG*RFFFAKCYGLNAELLTLLV 1 LMVLISGRNNKNQSPG LVSLVIGDYLA LNAELLTLLV Sbjct: 186 LMVLISGRNNKNQSPGRLVSLVIGDYLAC-----------------LNAELLTLLV 224 Score = 26.9 bits (58), Expect(2) = 3e-09 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -3 Query: 227 DGPPHPRALMSYGNSW 180 DG +P ALMSY NSW Sbjct: 166 DGMAYPIALMSYENSW 181