BLASTX nr result
ID: Paeonia23_contig00024856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00024856 (439 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308149.1| hypothetical protein POPTR_0006s08320g [Popu... 84 3e-14 gb|EXB88725.1| hypothetical protein L484_015415 [Morus notabilis] 81 2e-13 ref|XP_007145318.1| hypothetical protein PHAVU_007G229000g [Phas... 81 2e-13 ref|XP_004516197.1| PREDICTED: uncharacterized protein LOC101514... 81 2e-13 ref|XP_007204541.1| hypothetical protein PRUPE_ppa017106mg [Prun... 81 2e-13 gb|ACU16874.1| unknown [Glycine max] 81 2e-13 emb|CBI30282.3| unnamed protein product [Vitis vinifera] 80 2e-13 emb|CAN61197.1| hypothetical protein VITISV_028348 [Vitis vinifera] 80 2e-13 ref|XP_006594210.1| PREDICTED: uncharacterized protein LOC100789... 80 4e-13 ref|XP_002528726.1| conserved hypothetical protein [Ricinus comm... 80 4e-13 ref|XP_002266629.1| PREDICTED: uncharacterized protein LOC100243... 79 9e-13 ref|XP_006481795.1| PREDICTED: uncharacterized protein LOC102630... 78 1e-12 ref|XP_006430233.1| hypothetical protein CICLE_v10013416mg [Citr... 78 1e-12 ref|XP_006295356.1| hypothetical protein CARUB_v10024447mg [Caps... 78 1e-12 ref|XP_002881438.1| hypothetical protein ARALYDRAFT_482604 [Arab... 78 1e-12 ref|XP_002316503.1| hypothetical protein POPTR_0010s24410g [Popu... 78 1e-12 gb|ABK28025.1| unknown [Arabidopsis thaliana] 78 1e-12 dbj|BAD94703.1| hypothetical protein [Arabidopsis thaliana] 78 1e-12 ref|XP_006436622.1| hypothetical protein CICLE_v10033849mg [Citr... 77 2e-12 ref|XP_002524992.1| conserved hypothetical protein [Ricinus comm... 76 4e-12 >ref|XP_002308149.1| hypothetical protein POPTR_0006s08320g [Populus trichocarpa] gi|222854125|gb|EEE91672.1| hypothetical protein POPTR_0006s08320g [Populus trichocarpa] Length = 77 Score = 83.6 bits (205), Expect = 3e-14 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFSKP 188 ME+LNSKLYLQNCYI+KENERLRKKAQ LNQENQALLSE K K SKP Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLSKP 47 >gb|EXB88725.1| hypothetical protein L484_015415 [Morus notabilis] Length = 81 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFSK 191 ME+LNSKLYLQNCYI+KENERLRKKAQ LNQENQALLSE K K SK Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLSK 46 >ref|XP_007145318.1| hypothetical protein PHAVU_007G229000g [Phaseolus vulgaris] gi|593689400|ref|XP_007145319.1| hypothetical protein PHAVU_007G229000g [Phaseolus vulgaris] gi|593689402|ref|XP_007145320.1| hypothetical protein PHAVU_007G229000g [Phaseolus vulgaris] gi|561018508|gb|ESW17312.1| hypothetical protein PHAVU_007G229000g [Phaseolus vulgaris] gi|561018509|gb|ESW17313.1| hypothetical protein PHAVU_007G229000g [Phaseolus vulgaris] gi|561018510|gb|ESW17314.1| hypothetical protein PHAVU_007G229000g [Phaseolus vulgaris] Length = 75 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFSK 191 ME+LNSKLYLQNCYI+KENERLRKKAQ LNQENQALLSE K K SK Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLSK 46 >ref|XP_004516197.1| PREDICTED: uncharacterized protein LOC101514572 [Cicer arietinum] Length = 77 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFSK 191 ME+LNSKLYLQNCYI+KENERLRKKAQ LNQENQALLSE K K SK Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLSK 46 >ref|XP_007204541.1| hypothetical protein PRUPE_ppa017106mg [Prunus persica] gi|462400072|gb|EMJ05740.1| hypothetical protein PRUPE_ppa017106mg [Prunus persica] Length = 77 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFSK 191 ME+LNSKLYLQNCYI+KENERLRKKAQ LNQENQALLSE K K SK Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLSK 46 >gb|ACU16874.1| unknown [Glycine max] Length = 78 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFSK 191 ME+LNSKLYLQNCYI+KENERLRKKAQ LNQENQALLSE K K SK Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLSK 46 >emb|CBI30282.3| unnamed protein product [Vitis vinifera] Length = 77 Score = 80.5 bits (197), Expect = 2e-13 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFSK 191 ME+LNSKLYLQNCYII+ENERLRKKAQ LNQENQALLSE K K SK Sbjct: 1 MERLNSKLYLQNCYIIQENERLRKKAQLLNQENQALLSELKQKLSK 46 >emb|CAN61197.1| hypothetical protein VITISV_028348 [Vitis vinifera] Length = 114 Score = 80.5 bits (197), Expect = 2e-13 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFSK 191 ME+LNSKLYLQNCYII+ENERLRKKAQ LNQENQALLSE K K SK Sbjct: 38 MERLNSKLYLQNCYIIQENERLRKKAQLLNQENQALLSELKQKLSK 83 >ref|XP_006594210.1| PREDICTED: uncharacterized protein LOC100789735 isoform X1 [Glycine max] gi|571498413|ref|XP_006594211.1| PREDICTED: uncharacterized protein LOC100789735 isoform X2 [Glycine max] gi|571498415|ref|XP_006594212.1| PREDICTED: uncharacterized protein LOC100789735 isoform X3 [Glycine max] gi|571498417|ref|XP_006594213.1| PREDICTED: uncharacterized protein LOC100789735 isoform X4 [Glycine max] Length = 77 Score = 79.7 bits (195), Expect = 4e-13 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFSK 191 ME+LNSKLYLQNCYI+KENERLRKKAQ LNQENQALLSE K K S+ Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLSR 46 >ref|XP_002528726.1| conserved hypothetical protein [Ricinus communis] gi|223531820|gb|EEF33638.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 79.7 bits (195), Expect = 4e-13 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFSK 191 ME+LNSKLYLQNCYI+KENERLRKKAQ LNQENQALLSE K K +K Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLTK 46 >ref|XP_002266629.1| PREDICTED: uncharacterized protein LOC100243056 [Vitis vinifera] gi|296087972|emb|CBI35255.3| unnamed protein product [Vitis vinifera] Length = 75 Score = 78.6 bits (192), Expect = 9e-13 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFSK 191 MEKLNS+LYLQNCYII+ENERLRKKAQ+LNQENQALL+E K K K Sbjct: 1 MEKLNSELYLQNCYIIQENERLRKKAQQLNQENQALLAEMKEKLPK 46 >ref|XP_006481795.1| PREDICTED: uncharacterized protein LOC102630060 [Citrus sinensis] Length = 76 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFS 194 ME+LNSKLYLQNCYI+KENERLRKKAQ LNQENQALLSE K K + Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLA 45 >ref|XP_006430233.1| hypothetical protein CICLE_v10013416mg [Citrus clementina] gi|557532290|gb|ESR43473.1| hypothetical protein CICLE_v10013416mg [Citrus clementina] Length = 74 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFS 194 ME+LNSKLYLQNCYI+KENERLRKKAQ LNQENQALLSE K K + Sbjct: 1 MERLNSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLA 45 >ref|XP_006295356.1| hypothetical protein CARUB_v10024447mg [Capsella rubella] gi|482564064|gb|EOA28254.1| hypothetical protein CARUB_v10024447mg [Capsella rubella] Length = 77 Score = 77.8 bits (190), Expect = 1e-12 Identities = 39/46 (84%), Positives = 40/46 (86%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFSK 191 ME+LNSKLYLQNCYIIKENERLRKKAQ LNQENQ LL E K K SK Sbjct: 1 MERLNSKLYLQNCYIIKENERLRKKAQILNQENQQLLFELKQKLSK 46 >ref|XP_002881438.1| hypothetical protein ARALYDRAFT_482604 [Arabidopsis lyrata subsp. lyrata] gi|297327277|gb|EFH57697.1| hypothetical protein ARALYDRAFT_482604 [Arabidopsis lyrata subsp. lyrata] Length = 71 Score = 77.8 bits (190), Expect = 1e-12 Identities = 39/46 (84%), Positives = 40/46 (86%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFSK 191 ME+LNSKLYLQNCYIIKENERLRKKAQ LNQENQ LL E K K SK Sbjct: 1 MERLNSKLYLQNCYIIKENERLRKKAQILNQENQQLLFELKQKLSK 46 >ref|XP_002316503.1| hypothetical protein POPTR_0010s24410g [Populus trichocarpa] gi|222865543|gb|EEF02674.1| hypothetical protein POPTR_0010s24410g [Populus trichocarpa] Length = 61 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFSK 191 MEKLNS+LYLQNCYII++NE LRKKAQ LNQENQALLSE K K SK Sbjct: 1 MEKLNSQLYLQNCYIIQQNEMLRKKAQRLNQENQALLSELKQKLSK 46 >gb|ABK28025.1| unknown [Arabidopsis thaliana] Length = 73 Score = 77.8 bits (190), Expect = 1e-12 Identities = 39/46 (84%), Positives = 40/46 (86%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFSK 191 ME+LNSKLYLQNCYIIKENERLRKKAQ LNQENQ LL E K K SK Sbjct: 1 MERLNSKLYLQNCYIIKENERLRKKAQILNQENQQLLFELKQKLSK 46 >dbj|BAD94703.1| hypothetical protein [Arabidopsis thaliana] Length = 72 Score = 77.8 bits (190), Expect = 1e-12 Identities = 39/46 (84%), Positives = 40/46 (86%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFSK 191 ME+LNSKLYLQNCYIIKENERLRKKAQ LNQENQ LL E K K SK Sbjct: 1 MERLNSKLYLQNCYIIKENERLRKKAQILNQENQQLLFELKQKLSK 46 >ref|XP_006436622.1| hypothetical protein CICLE_v10033849mg [Citrus clementina] gi|557538818|gb|ESR49862.1| hypothetical protein CICLE_v10033849mg [Citrus clementina] Length = 73 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFSK 191 M+KLN++LYLQNCYII+ENE+LR+KAQ+LNQENQALLSE K K SK Sbjct: 1 MDKLNTQLYLQNCYIIQENEKLRRKAQQLNQENQALLSELKQKLSK 46 >ref|XP_002524992.1| conserved hypothetical protein [Ricinus communis] gi|223535736|gb|EEF37399.1| conserved hypothetical protein [Ricinus communis] Length = 68 Score = 76.3 bits (186), Expect = 4e-12 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -1 Query: 328 MEKLNSKLYLQNCYIIKENERLRKKAQELNQENQALLSEFKLKFSK 191 MEK+NSKLYLQNCY+I++NE LRKKAQ+LN+ENQALLSE K K SK Sbjct: 1 MEKVNSKLYLQNCYMIQQNEMLRKKAQQLNRENQALLSELKQKLSK 46