BLASTX nr result
ID: Paeonia23_contig00024714
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00024714 (296 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABO15468.1| 14-3-3 protein Lil 1433-3 [Lilium longiflorum] 56 5e-06 gb|EXC22076.1| 14-3-3-like protein GF14 iota [Morus notabilis] 55 8e-06 >gb|ABO15468.1| 14-3-3 protein Lil 1433-3 [Lilium longiflorum] Length = 260 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/42 (69%), Positives = 34/42 (80%), Gaps = 3/42 (7%) Frame = +2 Query: 32 MGTLS*ESYKDNILIRKLLRDNL---TSHLPEEGGEDGFKGE 148 + TLS ESYKD+ LI +LLRDNL TS LPE+GG+DGFKGE Sbjct: 209 LDTLSEESYKDSTLIMQLLRDNLTLWTSDLPEDGGDDGFKGE 250 >gb|EXC22076.1| 14-3-3-like protein GF14 iota [Morus notabilis] Length = 295 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 3/43 (6%) Frame = +2 Query: 29 NMGTLS*ESYKDNILIRKLLRDNL---TSHLPEEGGEDGFKGE 148 ++ TLS ESYKD+ LI +LLRDNL TS LPE+GGED FKGE Sbjct: 205 DLDTLSEESYKDSTLIMQLLRDNLTLWTSDLPEDGGEDNFKGE 247