BLASTX nr result
ID: Paeonia23_contig00024713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00024713 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACJ84305.1| unknown [Medicago truncatula] gi|388522647|gb|AFK... 68 1e-09 ref|XP_007142803.1| hypothetical protein PHAVU_007G018100g [Phas... 67 3e-09 ref|XP_003555859.1| PREDICTED: uncharacterized protein LOC100794... 67 3e-09 ref|XP_003536721.1| PREDICTED: uncharacterized protein LOC100790... 67 3e-09 gb|ACU19853.1| unknown [Glycine max] 67 3e-09 ref|XP_004497195.1| PREDICTED: uncharacterized protein LOC101503... 66 4e-09 ref|XP_004292635.1| PREDICTED: uncharacterized protein LOC101305... 65 1e-08 gb|EXB24027.1| hypothetical protein L484_006058 [Morus notabilis] 65 1e-08 ref|XP_006422536.1| hypothetical protein CICLE_v10028955mg [Citr... 64 3e-08 ref|XP_002521269.1| conserved hypothetical protein [Ricinus comm... 64 3e-08 gb|EYU37976.1| hypothetical protein MIMGU_mgv1a011109mg [Mimulus... 63 4e-08 ref|XP_002306195.2| hypothetical protein POPTR_0004s18360g [Popu... 63 5e-08 ref|XP_003558861.1| PREDICTED: uncharacterized protein LOC100842... 60 2e-07 ref|XP_006651018.1| PREDICTED: uncharacterized protein LOC102703... 60 3e-07 gb|EEE58290.1| hypothetical protein OsJ_09328 [Oryza sativa Japo... 60 3e-07 gb|EEC74473.1| hypothetical protein OsI_09923 [Oryza sativa Indi... 60 3e-07 ref|NP_001048900.1| Os03g0137300 [Oryza sativa Japonica Group] g... 60 3e-07 gb|ABF93866.1| expressed protein [Oryza sativa Japonica Group] 60 3e-07 ref|XP_004147053.1| PREDICTED: uncharacterized protein LOC101221... 60 4e-07 gb|EPS71263.1| hypothetical protein M569_03498, partial [Genlise... 59 7e-07 >gb|ACJ84305.1| unknown [Medicago truncatula] gi|388522647|gb|AFK49385.1| unknown [Medicago truncatula] Length = 287 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 ENWLQVDIVPFLGIRSPAA+VSE+II+SQ L SLYLR Sbjct: 251 ENWLQVDIVPFLGIRSPAAVVSEVIIISQFLVSLYLR 287 >ref|XP_007142803.1| hypothetical protein PHAVU_007G018100g [Phaseolus vulgaris] gi|561015993|gb|ESW14797.1| hypothetical protein PHAVU_007G018100g [Phaseolus vulgaris] Length = 281 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 ENWLQVDIVPFLGI SPAA+VSE+II+SQ L SLYLR Sbjct: 245 ENWLQVDIVPFLGIHSPAAVVSEIIIISQFLVSLYLR 281 >ref|XP_003555859.1| PREDICTED: uncharacterized protein LOC100794285 [Glycine max] Length = 280 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 ENWLQVDIVPFLGI SPAA+VSE+II+SQ L SLYLR Sbjct: 244 ENWLQVDIVPFLGIHSPAAVVSEIIIISQFLVSLYLR 280 >ref|XP_003536721.1| PREDICTED: uncharacterized protein LOC100790896 [Glycine max] Length = 280 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 ENWLQVDIVPFLGI SPAA+VSE+II+SQ L SLYLR Sbjct: 244 ENWLQVDIVPFLGIHSPAAVVSEIIIISQFLVSLYLR 280 >gb|ACU19853.1| unknown [Glycine max] Length = 94 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 ENWLQVDIVPFLGI SPAA+VSE+II+SQ L SLYLR Sbjct: 58 ENWLQVDIVPFLGIHSPAAVVSEIIIISQFLVSLYLR 94 >ref|XP_004497195.1| PREDICTED: uncharacterized protein LOC101503512 [Cicer arietinum] Length = 287 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 ENWLQVDIVPFLGI SPAA+VSE+II+SQ L SLYLR Sbjct: 251 ENWLQVDIVPFLGIHSPAAVVSEVIIISQFLVSLYLR 287 >ref|XP_004292635.1| PREDICTED: uncharacterized protein LOC101305242 [Fragaria vesca subsp. vesca] Length = 284 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 ENWLQVDIVPFLGI SPAA+VSE I+ SQLL SLYLR Sbjct: 248 ENWLQVDIVPFLGIHSPAAVVSEFILFSQLLVSLYLR 284 >gb|EXB24027.1| hypothetical protein L484_006058 [Morus notabilis] Length = 292 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 ENWLQVDIVPFLG+ SPAA+VSE+I++SQ L SLYLR Sbjct: 256 ENWLQVDIVPFLGLHSPAAVVSEVILISQFLVSLYLR 292 >ref|XP_006422536.1| hypothetical protein CICLE_v10028955mg [Citrus clementina] gi|568866710|ref|XP_006486692.1| PREDICTED: uncharacterized protein LOC102616324 [Citrus sinensis] gi|557524470|gb|ESR35776.1| hypothetical protein CICLE_v10028955mg [Citrus clementina] Length = 294 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 ENWLQVDIVPFLGI SPAA+VSE I+ SQ L SLYLR Sbjct: 258 ENWLQVDIVPFLGIHSPAAVVSEFILFSQFLVSLYLR 294 >ref|XP_002521269.1| conserved hypothetical protein [Ricinus communis] gi|223539537|gb|EEF41125.1| conserved hypothetical protein [Ricinus communis] Length = 293 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 ENWLQVDIVPFLGI SPAA+VSE I+ SQ L SLYLR Sbjct: 257 ENWLQVDIVPFLGIHSPAAVVSEFILFSQFLVSLYLR 293 >gb|EYU37976.1| hypothetical protein MIMGU_mgv1a011109mg [Mimulus guttatus] Length = 292 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 ENWLQVDIVPF+GI SPA++VSE I+VSQ L SLYLR Sbjct: 256 ENWLQVDIVPFMGIHSPASVVSEFILVSQFLISLYLR 292 >ref|XP_002306195.2| hypothetical protein POPTR_0004s18360g [Populus trichocarpa] gi|550341317|gb|EEE86706.2| hypothetical protein POPTR_0004s18360g [Populus trichocarpa] Length = 289 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 ENWLQVDIVPFLG+ SPAA+VSE I+ SQ L SLYLR Sbjct: 253 ENWLQVDIVPFLGLHSPAAVVSEFILFSQFLVSLYLR 289 >ref|XP_003558861.1| PREDICTED: uncharacterized protein LOC100842592 [Brachypodium distachyon] Length = 277 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 ENWLQVDIVPFLGI SPA +V+E I++SQLL SL++R Sbjct: 241 ENWLQVDIVPFLGIHSPAVVVTEFILLSQLLVSLFVR 277 >ref|XP_006651018.1| PREDICTED: uncharacterized protein LOC102703198, partial [Oryza brachyantha] Length = 228 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 ENWLQVD+VPFLG+ SPA +VSE I+ SQLL SL++R Sbjct: 192 ENWLQVDVVPFLGVHSPAVVVSEFILFSQLLVSLFVR 228 >gb|EEE58290.1| hypothetical protein OsJ_09328 [Oryza sativa Japonica Group] Length = 219 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 ENWLQVD+VPFLG+ SPA +VSE I+ SQLL SL++R Sbjct: 183 ENWLQVDVVPFLGVHSPAVVVSEFILFSQLLVSLFVR 219 >gb|EEC74473.1| hypothetical protein OsI_09923 [Oryza sativa Indica Group] Length = 219 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 ENWLQVD+VPFLG+ SPA +VSE I+ SQLL SL++R Sbjct: 183 ENWLQVDVVPFLGVHSPAVVVSEFILFSQLLVSLFVR 219 >ref|NP_001048900.1| Os03g0137300 [Oryza sativa Japonica Group] gi|113547371|dbj|BAF10814.1| Os03g0137300, partial [Oryza sativa Japonica Group] Length = 207 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 ENWLQVD+VPFLG+ SPA +VSE I+ SQLL SL++R Sbjct: 171 ENWLQVDVVPFLGVHSPAVVVSEFILFSQLLVSLFVR 207 >gb|ABF93866.1| expressed protein [Oryza sativa Japonica Group] Length = 281 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 ENWLQVD+VPFLG+ SPA +VSE I+ SQLL SL++R Sbjct: 245 ENWLQVDVVPFLGVHSPAVVVSEFILFSQLLVSLFVR 281 >ref|XP_004147053.1| PREDICTED: uncharacterized protein LOC101221865 [Cucumis sativus] gi|449518109|ref|XP_004166086.1| PREDICTED: uncharacterized LOC101221865 [Cucumis sativus] Length = 287 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 E+WLQVDIVPFLGI SPA +VSE ++ SQ L SLYLR Sbjct: 251 ESWLQVDIVPFLGIHSPATVVSEFVLFSQFLVSLYLR 287 >gb|EPS71263.1| hypothetical protein M569_03498, partial [Genlisea aurea] Length = 215 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = +2 Query: 65 ENWLQVDIVPFLGIRSPAAIVSELIIVSQLLASLYLR 175 E+WLQVDIVPF+G+ SPAA+V+E II SQ +ASL+LR Sbjct: 179 ESWLQVDIVPFMGVHSPAAVVAEFIIFSQFIASLWLR 215