BLASTX nr result
ID: Paeonia23_contig00024449
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00024449 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006431732.1| hypothetical protein CICLE_v10003993mg, part... 57 2e-06 >ref|XP_006431732.1| hypothetical protein CICLE_v10003993mg, partial [Citrus clementina] gi|557533854|gb|ESR44972.1| hypothetical protein CICLE_v10003993mg, partial [Citrus clementina] Length = 356 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/96 (34%), Positives = 46/96 (47%), Gaps = 4/96 (4%) Frame = -3 Query: 278 VVYWFA----RNIGVIVSFDMANEAFGEIKLPEFIPYNNIGVIVSSLTFLGDSLCVCLLK 111 V YW R++ VI+SF M NE F EIK+P + Y SS++ DSL + + Sbjct: 224 VCYWLVIADTRDLKVILSFHMDNEVFEEIKIPPHVNY------YSSISLYEDSLSIVIPD 277 Query: 110 RSLIVELWVMGAAESWTKHFTSDHYLTFSNPLGYLK 3 E+WVM + W KH T + F G+ K Sbjct: 278 AEQCFEIWVMNDNKCWAKHLTLGPFFNFRINFGFWK 313