BLASTX nr result
ID: Paeonia23_contig00024137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00024137 (236 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007207232.1| hypothetical protein PRUPE_ppa026856mg [Prun... 95 9e-18 ref|XP_007220384.1| hypothetical protein PRUPE_ppa021778mg [Prun... 95 1e-17 ref|XP_007210190.1| hypothetical protein PRUPE_ppa017790mg [Prun... 94 2e-17 ref|XP_007220740.1| hypothetical protein PRUPE_ppa023598mg [Prun... 93 3e-17 ref|XP_007216161.1| hypothetical protein PRUPE_ppa015308mg, part... 93 3e-17 ref|XP_007200198.1| hypothetical protein PRUPE_ppa016013mg, part... 93 3e-17 ref|XP_007212569.1| hypothetical protein PRUPE_ppa015570mg, part... 90 4e-16 ref|XP_007226836.1| hypothetical protein PRUPE_ppa017565mg, part... 86 5e-15 ref|XP_007219831.1| hypothetical protein PRUPE_ppb013564mg [Prun... 85 1e-14 gb|AAD19756.1| putative Ty3-gypsy-like retroelement pol polyprot... 82 8e-14 ref|XP_007200908.1| hypothetical protein PRUPE_ppb018196mg [Prun... 82 1e-13 ref|XP_004295592.1| PREDICTED: uncharacterized protein LOC101291... 81 1e-13 ref|XP_007199279.1| hypothetical protein PRUPE_ppa022873mg [Prun... 79 7e-13 emb|CAN79395.1| hypothetical protein VITISV_010430 [Vitis vinifera] 77 2e-12 dbj|BAF01788.1| putative Ty3-gypsy-like retroelement pol polypro... 77 3e-12 ref|XP_007206637.1| hypothetical protein PRUPE_ppa021001mg [Prun... 76 6e-12 ref|XP_004154771.1| PREDICTED: kanadaptin-like [Cucumis sativus] 75 1e-11 emb|CAN79625.1| hypothetical protein VITISV_035899 [Vitis vinifera] 72 6e-11 ref|XP_007213052.1| hypothetical protein PRUPE_ppa020415mg, part... 69 5e-10 ref|XP_007010495.1| Uncharacterized protein TCM_044370 [Theobrom... 69 7e-10 >ref|XP_007207232.1| hypothetical protein PRUPE_ppa026856mg [Prunus persica] gi|462402874|gb|EMJ08431.1| hypothetical protein PRUPE_ppa026856mg [Prunus persica] Length = 1493 Score = 95.1 bits (235), Expect = 9e-18 Identities = 44/75 (58%), Positives = 57/75 (76%) Frame = +2 Query: 11 MSAENFVEKLQQTQAEVKENLEQANEKNKARVDKHRRAKVFEVGDLVMVFLSKGRFPAGT 190 ++A+N E++ + EVK+ LEQ N K KA D+HRR KVF+ GD VMVFL K RFPAGT Sbjct: 1352 VAAKNLAEEVVAVRDEVKQKLEQTNAKYKAAADRHRRVKVFQEGDSVMVFLRKERFPAGT 1411 Query: 191 YNKLKKRRYGPYKIL 235 Y+KLK ++YGPYK+L Sbjct: 1412 YSKLKPKKYGPYKVL 1426 >ref|XP_007220384.1| hypothetical protein PRUPE_ppa021778mg [Prunus persica] gi|462416846|gb|EMJ21583.1| hypothetical protein PRUPE_ppa021778mg [Prunus persica] Length = 1384 Score = 94.7 bits (234), Expect = 1e-17 Identities = 43/75 (57%), Positives = 57/75 (76%) Frame = +2 Query: 11 MSAENFVEKLQQTQAEVKENLEQANEKNKARVDKHRRAKVFEVGDLVMVFLSKGRFPAGT 190 ++A+N E++ + EVK+ LEQ N K KA D+HRR KVF+ GD VM+FL K RFPAGT Sbjct: 1243 VAAKNLAEEVVAVRDEVKQKLEQTNAKYKAAADRHRRVKVFQEGDSVMIFLRKERFPAGT 1302 Query: 191 YNKLKKRRYGPYKIL 235 Y+KLK ++YGPYK+L Sbjct: 1303 YSKLKPKKYGPYKVL 1317 >ref|XP_007210190.1| hypothetical protein PRUPE_ppa017790mg [Prunus persica] gi|462405925|gb|EMJ11389.1| hypothetical protein PRUPE_ppa017790mg [Prunus persica] Length = 1485 Score = 94.4 bits (233), Expect = 2e-17 Identities = 43/75 (57%), Positives = 56/75 (74%) Frame = +2 Query: 11 MSAENFVEKLQQTQAEVKENLEQANEKNKARVDKHRRAKVFEVGDLVMVFLSKGRFPAGT 190 ++A+N E++ + EVK+ LEQ N K KA DKHRR KVF+ GD VM+FL K RFP GT Sbjct: 1344 VAAKNLAEEVVAVRDEVKQKLEQTNAKYKAAADKHRRVKVFQEGDSVMIFLRKERFPVGT 1403 Query: 191 YNKLKKRRYGPYKIL 235 Y+KLK ++YGPYK+L Sbjct: 1404 YSKLKPKKYGPYKVL 1418 >ref|XP_007220740.1| hypothetical protein PRUPE_ppa023598mg [Prunus persica] gi|462417202|gb|EMJ21939.1| hypothetical protein PRUPE_ppa023598mg [Prunus persica] Length = 1457 Score = 93.2 bits (230), Expect = 3e-17 Identities = 42/75 (56%), Positives = 56/75 (74%) Frame = +2 Query: 11 MSAENFVEKLQQTQAEVKENLEQANEKNKARVDKHRRAKVFEVGDLVMVFLSKGRFPAGT 190 ++A+N E++ + EVK+ LEQ N K KA D+HRR KVF+ GD VM+FL K RFP GT Sbjct: 1302 VAAKNLAEEVVAVRDEVKQKLEQTNAKYKAAADRHRRVKVFQEGDSVMIFLRKERFPVGT 1361 Query: 191 YNKLKKRRYGPYKIL 235 Y+KLK ++YGPYK+L Sbjct: 1362 YSKLKPKKYGPYKVL 1376 >ref|XP_007216161.1| hypothetical protein PRUPE_ppa015308mg, partial [Prunus persica] gi|462412311|gb|EMJ17360.1| hypothetical protein PRUPE_ppa015308mg, partial [Prunus persica] Length = 1150 Score = 93.2 bits (230), Expect = 3e-17 Identities = 42/75 (56%), Positives = 56/75 (74%) Frame = +2 Query: 11 MSAENFVEKLQQTQAEVKENLEQANEKNKARVDKHRRAKVFEVGDLVMVFLSKGRFPAGT 190 ++A+N E++ + EVK+ LEQ N K KA D+HRR KVF+ GD VM+FL K RFP GT Sbjct: 1042 VAAKNLAEEVVAVRDEVKQKLEQTNAKYKAAADRHRRVKVFQEGDSVMIFLRKERFPVGT 1101 Query: 191 YNKLKKRRYGPYKIL 235 Y+KLK ++YGPYK+L Sbjct: 1102 YSKLKPKKYGPYKVL 1116 >ref|XP_007200198.1| hypothetical protein PRUPE_ppa016013mg, partial [Prunus persica] gi|462395598|gb|EMJ01397.1| hypothetical protein PRUPE_ppa016013mg, partial [Prunus persica] Length = 1057 Score = 93.2 bits (230), Expect = 3e-17 Identities = 42/75 (56%), Positives = 56/75 (74%) Frame = +2 Query: 11 MSAENFVEKLQQTQAEVKENLEQANEKNKARVDKHRRAKVFEVGDLVMVFLSKGRFPAGT 190 ++A+N E++ + EVK+ LEQ N K KA D+HRR KVF+ GD VM+FL K RFP GT Sbjct: 910 VAAKNLAEEVVAVRDEVKQKLEQTNAKYKAAADRHRRVKVFQEGDSVMIFLRKERFPVGT 969 Query: 191 YNKLKKRRYGPYKIL 235 Y+KLK ++YGPYK+L Sbjct: 970 YSKLKPKKYGPYKVL 984 >ref|XP_007212569.1| hypothetical protein PRUPE_ppa015570mg, partial [Prunus persica] gi|462408434|gb|EMJ13768.1| hypothetical protein PRUPE_ppa015570mg, partial [Prunus persica] Length = 541 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/75 (54%), Positives = 54/75 (72%) Frame = +2 Query: 11 MSAENFVEKLQQTQAEVKENLEQANEKNKARVDKHRRAKVFEVGDLVMVFLSKGRFPAGT 190 ++A+N E++ + EVK+ LEQ N K KA D+HRR KVF GD VM+FL K RFP T Sbjct: 433 VAAKNLAEEVVAVRDEVKQKLEQTNAKYKASADRHRRVKVFREGDSVMIFLRKERFPVDT 492 Query: 191 YNKLKKRRYGPYKIL 235 Y+KLK ++YGPYK+L Sbjct: 493 YSKLKPKKYGPYKVL 507 >ref|XP_007226836.1| hypothetical protein PRUPE_ppa017565mg, partial [Prunus persica] gi|462423772|gb|EMJ28035.1| hypothetical protein PRUPE_ppa017565mg, partial [Prunus persica] Length = 914 Score = 85.9 bits (211), Expect = 5e-15 Identities = 40/71 (56%), Positives = 51/71 (71%) Frame = +2 Query: 23 NFVEKLQQTQAEVKENLEQANEKNKARVDKHRRAKVFEVGDLVMVFLSKGRFPAGTYNKL 202 N +++ + EVK+ LEQ N K KA DKHRR +VF+ GD VMVFL RF AGTY+KL Sbjct: 818 NLAKEVVAVRDEVKQKLEQTNAKYKAAADKHRRVRVFQEGDFVMVFLRMERFRAGTYSKL 877 Query: 203 KKRRYGPYKIL 235 K ++YGPYK+L Sbjct: 878 KPKKYGPYKVL 888 >ref|XP_007219831.1| hypothetical protein PRUPE_ppb013564mg [Prunus persica] gi|462416293|gb|EMJ21030.1| hypothetical protein PRUPE_ppb013564mg [Prunus persica] Length = 964 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/74 (55%), Positives = 50/74 (67%) Frame = +2 Query: 14 SAENFVEKLQQTQAEVKENLEQANEKNKARVDKHRRAKVFEVGDLVMVFLSKGRFPAGTY 193 +AE+ E +Q + EVKE LE+ N K K +KHRR KVF GD VMV+L RF GTY Sbjct: 825 AAEHMAENVQAVKNEVKETLEKTNAKYKEAANKHRRVKVFNEGDFVMVYLKNERFLMGTY 884 Query: 194 NKLKKRRYGPYKIL 235 KL+ R+YGPYKIL Sbjct: 885 RKLQPRKYGPYKIL 898 >gb|AAD19756.1| putative Ty3-gypsy-like retroelement pol polyprotein [Arabidopsis thaliana] Length = 280 Score = 82.0 bits (201), Expect = 8e-14 Identities = 40/74 (54%), Positives = 49/74 (66%) Frame = +2 Query: 14 SAENFVEKLQQTQAEVKENLEQANEKNKARVDKHRRAKVFEVGDLVMVFLSKGRFPAGTY 193 SAE E++ + VK LE +KNK DK RR KVF+ GD VMV L KGRF GTY Sbjct: 150 SAETMAEEILVVKEVVKAKLEATGKKNKVAADKRRRFKVFKEGDDVMVLLRKGRFAVGTY 209 Query: 194 NKLKKRRYGPYKIL 235 NK+K R+YGP+K+L Sbjct: 210 NKVKPRKYGPFKVL 223 >ref|XP_007200908.1| hypothetical protein PRUPE_ppb018196mg [Prunus persica] gi|462396308|gb|EMJ02107.1| hypothetical protein PRUPE_ppb018196mg [Prunus persica] Length = 532 Score = 81.6 bits (200), Expect = 1e-13 Identities = 39/60 (65%), Positives = 44/60 (73%) Frame = +2 Query: 56 EVKENLEQANEKNKARVDKHRRAKVFEVGDLVMVFLSKGRFPAGTYNKLKKRRYGPYKIL 235 EV E LE+ N K KA DKHRR KVF GD VMV+ K RFP GTY+KL+ R+YGPYKIL Sbjct: 466 EVNERLEKTNAKCKATTDKHRRVKVFNEGDSVMVYPKKERFPVGTYSKLQPRKYGPYKIL 525 >ref|XP_004295592.1| PREDICTED: uncharacterized protein LOC101291324 [Fragaria vesca subsp. vesca] Length = 2122 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/59 (62%), Positives = 45/59 (76%) Frame = +2 Query: 59 VKENLEQANEKNKARVDKHRRAKVFEVGDLVMVFLSKGRFPAGTYNKLKKRRYGPYKIL 235 V+ LE N KNKA DKHRR K+F+ GD VMVFL K RFP GTYNKL+ ++YGP+K+L Sbjct: 1361 VRAKLEATNAKNKAAADKHRRIKLFKEGDDVMVFLRKERFPVGTYNKLQPKKYGPFKVL 1419 >ref|XP_007199279.1| hypothetical protein PRUPE_ppa022873mg [Prunus persica] gi|462394679|gb|EMJ00478.1| hypothetical protein PRUPE_ppa022873mg [Prunus persica] Length = 777 Score = 79.0 bits (193), Expect = 7e-13 Identities = 37/60 (61%), Positives = 42/60 (70%) Frame = +2 Query: 56 EVKENLEQANEKNKARVDKHRRAKVFEVGDLVMVFLSKGRFPAGTYNKLKKRRYGPYKIL 235 EVKE LE+ N K KA DKHRR KVF GD +MV+L RFP GTY KL+ +YGP KIL Sbjct: 620 EVKERLEKTNAKYKAATDKHRRVKVFNEGDFIMVYLKNERFPMGTYRKLQPHKYGPSKIL 679 >emb|CAN79395.1| hypothetical protein VITISV_010430 [Vitis vinifera] Length = 391 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/74 (50%), Positives = 48/74 (64%) Frame = +2 Query: 14 SAENFVEKLQQTQAEVKENLEQANEKNKARVDKHRRAKVFEVGDLVMVFLSKGRFPAGTY 193 + E F E +QQ EVK+NLE+ N K D+HR K+F GDLVMV K FP GTY Sbjct: 253 NTEEFAEPIQQIYQEVKKNLEKVNLCYKTASDRHRCLKLFNEGDLVMVHFCKNCFPIGTY 312 Query: 194 NKLKKRRYGPYKIL 235 NKLK ++ GP+++L Sbjct: 313 NKLKDKKIGPFRVL 326 >dbj|BAF01788.1| putative Ty3-gypsy-like retroelement pol polyprotein [Arabidopsis thaliana] Length = 127 Score = 77.0 bits (188), Expect = 3e-12 Identities = 37/68 (54%), Positives = 46/68 (67%) Frame = +2 Query: 32 EKLQQTQAEVKENLEQANEKNKARVDKHRRAKVFEVGDLVMVFLSKGRFPAGTYNKLKKR 211 E++ + VK LE +KNK DK RR KVF+ GD VMV L KGRF GTYNK+K R Sbjct: 3 EEILVVKEVVKAKLEATGKKNKVAADKRRRFKVFKEGDDVMVLLRKGRFAVGTYNKVKPR 62 Query: 212 RYGPYKIL 235 +YGP+K+L Sbjct: 63 KYGPFKVL 70 >ref|XP_007206637.1| hypothetical protein PRUPE_ppa021001mg [Prunus persica] gi|462402279|gb|EMJ07836.1| hypothetical protein PRUPE_ppa021001mg [Prunus persica] Length = 590 Score = 75.9 bits (185), Expect = 6e-12 Identities = 35/60 (58%), Positives = 44/60 (73%) Frame = +2 Query: 56 EVKENLEQANEKNKARVDKHRRAKVFEVGDLVMVFLSKGRFPAGTYNKLKKRRYGPYKIL 235 EVKE LE+ N K+KA DKHR+ KVF G+ VMV++ K RF G + KL+ R+YGPYKIL Sbjct: 441 EVKERLEKTNAKHKAAADKHRQVKVFNEGNSVMVYMKKERFSMGAHRKLQPRKYGPYKIL 500 >ref|XP_004154771.1| PREDICTED: kanadaptin-like [Cucumis sativus] Length = 962 Score = 74.7 bits (182), Expect = 1e-11 Identities = 35/73 (47%), Positives = 47/73 (64%) Frame = +2 Query: 17 AENFVEKLQQTQAEVKENLEQANEKNKARVDKHRRAKVFEVGDLVMVFLSKGRFPAGTYN 196 AE VEK+Q EV +L+++ + K D+ RR F GDLVM+ L K RFP GTYN Sbjct: 304 AEKMVEKIQNLHEEVHNHLKESTQSYKKAADRKRRQATFTEGDLVMIHLRKIRFPTGTYN 363 Query: 197 KLKKRRYGPYKIL 235 KLK R+ GP+++L Sbjct: 364 KLKDRQLGPFRVL 376 >emb|CAN79625.1| hypothetical protein VITISV_035899 [Vitis vinifera] Length = 866 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/74 (48%), Positives = 48/74 (64%) Frame = +2 Query: 14 SAENFVEKLQQTQAEVKENLEQANEKNKARVDKHRRAKVFEVGDLVMVFLSKGRFPAGTY 193 +AE F E++QQ EVK+NLE+ N K D+H+R K+F GDLVMV+L K FP TY Sbjct: 735 NAEEFAERIQQIHLEVKKNLEKVNLHYKIVADQHQRLKLFNEGDLVMVYLRKNHFPTCTY 794 Query: 194 NKLKKRRYGPYKIL 235 N K GP+++L Sbjct: 795 NNAYK--IGPFRVL 806 >ref|XP_007213052.1| hypothetical protein PRUPE_ppa020415mg, partial [Prunus persica] gi|462408917|gb|EMJ14251.1| hypothetical protein PRUPE_ppa020415mg, partial [Prunus persica] Length = 840 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = +2 Query: 101 RVDKHRRAKVFEVGDLVMVFLSKGRFPAGTYNKLKKRRYGPYKIL 235 R +KHRR KVF+ GD VMVFL + RFP GTY+KLK ++YGPYK+L Sbjct: 792 RCNKHRRVKVFQEGDYVMVFLREERFPVGTYSKLKPKKYGPYKVL 836 >ref|XP_007010495.1| Uncharacterized protein TCM_044370 [Theobroma cacao] gi|508727408|gb|EOY19305.1| Uncharacterized protein TCM_044370 [Theobroma cacao] Length = 1306 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/72 (44%), Positives = 48/72 (66%) Frame = +2 Query: 20 ENFVEKLQQTQAEVKENLEQANEKNKARVDKHRRAKVFEVGDLVMVFLSKGRFPAGTYNK 199 E F + +Q+ EVK L+ +N + ++HRR + FE GD V+V+L + RFP GTY+K Sbjct: 1160 ELFADHIQKIHEEVKAALKASNAEYSFTANQHRRKQEFEEGDQVLVYLRQERFPKGTYHK 1219 Query: 200 LKKRRYGPYKIL 235 LK R++GP K+L Sbjct: 1220 LKSRKFGPCKVL 1231