BLASTX nr result
ID: Paeonia23_contig00024070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00024070 (581 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266084.1| PREDICTED: uncharacterized LOC100260232 [Vit... 56 6e-06 >ref|XP_002266084.1| PREDICTED: uncharacterized LOC100260232 [Vitis vinifera] gi|296087966|emb|CBI35249.3| unnamed protein product [Vitis vinifera] Length = 435 Score = 56.2 bits (134), Expect = 6e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 37 QMLALPLLNPLVGEKQILCTAILASIAYVLLYDL 138 QML LPL+NPLVGEK ILCTA+LASIAY L Y L Sbjct: 282 QMLILPLINPLVGEKLILCTALLASIAYALFYGL 315