BLASTX nr result
ID: Paeonia23_contig00023824
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00023824 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB69102.1| hypothetical protein L484_017380 [Morus notabilis] 75 7e-12 emb|CBI35789.3| unnamed protein product [Vitis vinifera] 75 1e-11 ref|XP_002271048.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_007208935.1| hypothetical protein PRUPE_ppb014337mg, part... 74 3e-11 ref|XP_002322098.1| hypothetical protein POPTR_0015s04490g [Popu... 74 3e-11 ref|XP_004160441.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 ref|XP_004137553.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 ref|XP_006341533.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_002529554.1| pentatricopeptide repeat-containing protein,... 68 1e-09 ref|XP_007036793.1| Pentatricopeptide repeat (PPR) superfamily p... 67 3e-09 ref|XP_004236430.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|NP_188429.1| pentatricopeptide repeat-containing protein [Ar... 67 3e-09 ref|XP_006299483.1| hypothetical protein CARUB_v10015648mg [Caps... 66 4e-09 ref|XP_006406664.1| hypothetical protein EUTSA_v10020183mg [Eutr... 64 2e-08 ref|XP_002883101.1| pentatricopeptide repeat-containing protein ... 64 2e-08 ref|XP_006478000.1| PREDICTED: pentatricopeptide repeat-containi... 62 8e-08 ref|XP_004301253.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 emb|CAN79606.1| hypothetical protein VITISV_027500 [Vitis vinifera] 57 4e-06 >gb|EXB69102.1| hypothetical protein L484_017380 [Morus notabilis] Length = 714 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/63 (55%), Positives = 45/63 (71%) Frame = +1 Query: 133 NSLATISMVII*DEKIADRSHWTKMIHTICKRNRNVDEAIRLVDRFRLHGYRPDSLNLSS 312 NS + + V + D+S+WTK IH +C R+RNVDEA+ L+DR L GYRPDSLNLSS Sbjct: 53 NSFSALEQV-----SVDDKSYWTKTIHNLCTRHRNVDEALCLLDRLSLRGYRPDSLNLSS 107 Query: 313 IIH 321 I+H Sbjct: 108 IVH 110 >emb|CBI35789.3| unnamed protein product [Vitis vinifera] Length = 912 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/51 (62%), Positives = 42/51 (82%) Frame = +1 Query: 169 DEKIADRSHWTKMIHTICKRNRNVDEAIRLVDRFRLHGYRPDSLNLSSIIH 321 +E I +++ W++ IH +C R+RNVDEA+RL+D RL GYRPDSLNLSSIIH Sbjct: 286 EESIINKAFWSRKIHNLCTRDRNVDEALRLLDLLRLRGYRPDSLNLSSIIH 336 >ref|XP_002271048.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like [Vitis vinifera] Length = 680 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/51 (62%), Positives = 42/51 (82%) Frame = +1 Query: 169 DEKIADRSHWTKMIHTICKRNRNVDEAIRLVDRFRLHGYRPDSLNLSSIIH 321 +E I +++ W++ IH +C R+RNVDEA+RL+D RL GYRPDSLNLSSIIH Sbjct: 54 EESIINKAFWSRKIHNLCTRDRNVDEALRLLDLLRLRGYRPDSLNLSSIIH 104 >ref|XP_007208935.1| hypothetical protein PRUPE_ppb014337mg, partial [Prunus persica] gi|462404670|gb|EMJ10134.1| hypothetical protein PRUPE_ppb014337mg, partial [Prunus persica] Length = 681 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/48 (66%), Positives = 41/48 (85%) Frame = +1 Query: 178 IADRSHWTKMIHTICKRNRNVDEAIRLVDRFRLHGYRPDSLNLSSIIH 321 I +RS+WTK IH++C +RNVD+A+ L+DR RL GYRPDSLNLSSI+H Sbjct: 43 IDNRSYWTKKIHSLCTAHRNVDQALHLLDRLRLLGYRPDSLNLSSILH 90 >ref|XP_002322098.1| hypothetical protein POPTR_0015s04490g [Populus trichocarpa] gi|222869094|gb|EEF06225.1| hypothetical protein POPTR_0015s04490g [Populus trichocarpa] Length = 668 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = +1 Query: 178 IADRSHWTKMIHTICKRNRNVDEAIRLVDRFRLHGYRPDSLNLSSIIH 321 I +RS+WT+ IH +C ++RNVDEA+RL+D RL GY PDSLNLSSIIH Sbjct: 46 ITNRSYWTQKIHDLCTKHRNVDEALRLLDHLRLRGYLPDSLNLSSIIH 93 >ref|XP_004160441.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like [Cucumis sativus] Length = 681 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/51 (56%), Positives = 41/51 (80%) Frame = +1 Query: 169 DEKIADRSHWTKMIHTICKRNRNVDEAIRLVDRFRLHGYRPDSLNLSSIIH 321 +E +AD S+WTK IH +C ++RNVDEA++L+D RLHGY+ LNL+S+IH Sbjct: 47 EESVADVSYWTKKIHGLCTKDRNVDEALQLLDALRLHGYQFHPLNLASVIH 97 >ref|XP_004137553.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like [Cucumis sativus] Length = 646 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = +1 Query: 172 EKIADRSHWTKMIHTICKRNRNVDEAIRLVDRFRLHGYRPDSLNLSSIIH 321 E +AD S+WTK IH +C ++RNVDEA++L+D RLHGY+ LNL+S+IH Sbjct: 15 ESVADVSYWTKKIHGLCTKDRNVDEALQLLDALRLHGYQFHPLNLASVIH 64 >ref|XP_006341533.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like [Solanum tuberosum] Length = 680 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = +1 Query: 184 DRSHWTKMIHTICKRNRNVDEAIRLVDRFRLHGYRPDSLNLSSIIH 321 DR++WT+ IH +C + NVDEA+RL+D RL GY PDSLNLSSI+H Sbjct: 45 DRAYWTRRIHKLCAIDGNVDEALRLLDGLRLQGYHPDSLNLSSIVH 90 >ref|XP_002529554.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530966|gb|EEF32823.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 678 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/48 (62%), Positives = 36/48 (75%) Frame = +1 Query: 178 IADRSHWTKMIHTICKRNRNVDEAIRLVDRFRLHGYRPDSLNLSSIIH 321 I + S+WTK IH +C + R VDEA+ L+D RL GYRPDSLN SSIIH Sbjct: 54 ITNSSYWTKKIHLLCTQQRKVDEALTLLDHLRLSGYRPDSLNFSSIIH 101 >ref|XP_007036793.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] gi|508774038|gb|EOY21294.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 690 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/50 (58%), Positives = 37/50 (74%) Frame = +1 Query: 172 EKIADRSHWTKMIHTICKRNRNVDEAIRLVDRFRLHGYRPDSLNLSSIIH 321 + I ++ +W IH +C ++RNVDEAI L+D LHGYRPD LNLSSIIH Sbjct: 49 QPITNKPYWATKIHNLCTKHRNVDEAISLLDTLCLHGYRPDYLNLSSIIH 98 >ref|XP_004236430.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like [Solanum lycopersicum] Length = 676 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = +1 Query: 184 DRSHWTKMIHTICKRNRNVDEAIRLVDRFRLHGYRPDSLNLSSIIH 321 DR++WT+ IH +C + +VDEA+RL+D RL GY PDSLNLSSI+H Sbjct: 45 DRAYWTRRIHKLCAIDGDVDEALRLLDELRLQGYHPDSLNLSSIVH 90 >ref|NP_188429.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75274006|sp|Q9LSK8.1|PP240_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g18020 gi|11994208|dbj|BAB01330.1| unnamed protein product [Arabidopsis thaliana] gi|332642514|gb|AEE76035.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 688 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = +1 Query: 178 IADRSHWTKMIHTICKRNRNVDEAIRLVDRFRLHGYRPDSLNLSSIIH 321 + DR++W + IH+IC RN DEA+R++D L GYRPDSLNLSS+IH Sbjct: 51 VTDRAYWRRRIHSICAVRRNPDEALRILDGLCLRGYRPDSLNLSSVIH 98 >ref|XP_006299483.1| hypothetical protein CARUB_v10015648mg [Capsella rubella] gi|482568192|gb|EOA32381.1| hypothetical protein CARUB_v10015648mg [Capsella rubella] Length = 687 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/48 (56%), Positives = 38/48 (79%) Frame = +1 Query: 178 IADRSHWTKMIHTICKRNRNVDEAIRLVDRFRLHGYRPDSLNLSSIIH 321 + DR++W + IH+IC ++N DEA+R++D L GYRPDSLNLSS+IH Sbjct: 58 VTDRAYWRRRIHSICAVHQNPDEALRIIDGLCLRGYRPDSLNLSSVIH 105 >ref|XP_006406664.1| hypothetical protein EUTSA_v10020183mg [Eutrema salsugineum] gi|557107810|gb|ESQ48117.1| hypothetical protein EUTSA_v10020183mg [Eutrema salsugineum] Length = 694 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = +1 Query: 178 IADRSHWTKMIHTICKRNRNVDEAIRLVDRFRLHGYRPDSLNLSSIIH 321 + DR++W + IH+ C RN DEA+R++D L GYRPDSLNLSS+IH Sbjct: 65 VTDRAYWRRRIHSSCTVRRNPDEALRILDGLCLRGYRPDSLNLSSVIH 112 >ref|XP_002883101.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297328941|gb|EFH59360.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 689 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/48 (56%), Positives = 37/48 (77%) Frame = +1 Query: 178 IADRSHWTKMIHTICKRNRNVDEAIRLVDRFRLHGYRPDSLNLSSIIH 321 + +R++W + IH+IC RN DEA+R++D L GYRPDSLNLSS+IH Sbjct: 51 VTNRAYWRRRIHSICAVRRNPDEALRVLDGLCLRGYRPDSLNLSSVIH 98 >ref|XP_006478000.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like isoform X1 [Citrus sinensis] gi|568848405|ref|XP_006478001.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like isoform X2 [Citrus sinensis] gi|568848407|ref|XP_006478002.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like isoform X3 [Citrus sinensis] gi|568848409|ref|XP_006478003.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like isoform X4 [Citrus sinensis] Length = 676 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +1 Query: 199 TKMIHTICKRNRNVDEAIRLVDRFRLHGYRPDSLNLSSIIH 321 TK IH +C ++RNVDEA+R +D R+ GYRP+SLN+SSIIH Sbjct: 54 TKKIHRLCTKDRNVDEALRFLDHLRIFGYRPNSLNISSIIH 94 >ref|XP_004301253.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like [Fragaria vesca subsp. vesca] Length = 682 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = +1 Query: 193 HWTKMIHTICKRNRNVDEAIRLVDRFRLHGYRPDSLNLSSIIH 321 +WTK IH +C R+RNVD+A+ L+D L GYRP LNL+SI+H Sbjct: 46 YWTKTIHHLCTRHRNVDQALHLLDHLHLRGYRPVPLNLTSIVH 88 >emb|CAN79606.1| hypothetical protein VITISV_027500 [Vitis vinifera] Length = 959 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 214 TICKRNRNVDEAIRLVDRFRLHGYRPDSLNLSSIIH 321 T R+RNVDEA+RL+D RL GYRPDSLNLSSIIH Sbjct: 359 TSSTRDRNVDEALRLLDLLRLRGYRPDSLNLSSIIH 394