BLASTX nr result
ID: Paeonia23_contig00023384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00023384 (210 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007219745.1| hypothetical protein PRUPE_ppa024149mg [Prun... 57 3e-06 >ref|XP_007219745.1| hypothetical protein PRUPE_ppa024149mg [Prunus persica] gi|462416207|gb|EMJ20944.1| hypothetical protein PRUPE_ppa024149mg [Prunus persica] Length = 309 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/71 (46%), Positives = 43/71 (60%), Gaps = 2/71 (2%) Frame = +2 Query: 2 YKVIRIVSFSWEYNPSQVEVYSLSRDTWRIINAIPLATFINDTHGSVYLNGIAYWICREN 181 YKV+RI FS + VEVYSL D+WRIINA+P T YLNG+ YWI +E Sbjct: 167 YKVVRIARFS---HGICVEVYSLGLDSWRIINALPPVTSDVWNEKWAYLNGVVYWIVQEF 223 Query: 182 YEEY--LLSFD 208 ++ ++SFD Sbjct: 224 SPDWRDIISFD 234