BLASTX nr result
ID: Paeonia23_contig00023240
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00023240 (213 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514871.1| hypothetical protein RCOM_1078930 [Ricinus c... 56 6e-06 >ref|XP_002514871.1| hypothetical protein RCOM_1078930 [Ricinus communis] gi|223545922|gb|EEF47425.1| hypothetical protein RCOM_1078930 [Ricinus communis] Length = 389 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +1 Query: 1 EKLMGLVKDLLVRNEMQTRLLSSLSERVEQLEKTFMSD 114 EK+MGL+ L RNEMQTRLLSSLS+RVEQLE+ FM + Sbjct: 321 EKMMGLMTQLFQRNEMQTRLLSSLSQRVEQLERAFMCE 358