BLASTX nr result
ID: Paeonia23_contig00023056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00023056 (721 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAZ03964.1| Ycf3 [Ranunculus macranthus] 91 5e-16 gb|AGJ51257.1| photosystem I assembly protein Ycf3 (chloroplast)... 90 7e-16 ref|YP_008963481.1| hypothetical chloroplast RF34 (chloroplast) ... 89 1e-15 ref|YP_005089148.1| ycf3 gene product [Rhynchoryza subulata] gi|... 89 2e-15 ref|YP_005088011.1| ycf3 gene product [Leersia tisserantii] gi|3... 89 2e-15 gb|AGP50756.1| hypothetical chloroplast RF34 (chloroplast) [Hord... 88 3e-15 ref|YP_008592640.1| photosystem I assembly protein ycf3 (chlorop... 88 3e-15 gb|AFB70727.1| photosystem I assembly protein Ycf3, partial (chl... 88 3e-15 gb|ADD30856.1| putative RF3 protein [Dillenia indica] 88 3e-15 gb|AGU00059.1| hypothetical chloroplast RF34 (chloroplast) [Glyc... 87 4e-15 ref|YP_008999936.1| hypothetical chloroplast RF34 (chloroplast) ... 87 4e-15 ref|YP_008993263.1| hypothetical chloroplast RF34 (chloroplast) ... 87 4e-15 ref|YP_008994480.1| hypothetical chloroplast RF34 (chloroplast) ... 87 4e-15 gb|AFK81300.1| hypothetical chloroplast RF34 [Camellia sinensis ... 87 4e-15 ref|YP_008963606.1| photosystem I assembly protein Ycf3 (chlorop... 87 4e-15 ref|YP_008814857.1| hypothetical chloroplast RF21 (chloroplast) ... 87 4e-15 gb|AGW96677.1| hypothetical chloroplast RF34 (chloroplast) [Argy... 87 4e-15 gb|AGQ50350.1| hypothetical chloroplast RF34 (chloroplast) [Rume... 87 4e-15 ref|YP_008081266.1| hypothetical chloroplast RF34 (chloroplast) ... 87 4e-15 ref|YP_007317249.1| photosystem I assembly protein Ycf3 (chlorop... 87 4e-15 >gb|AAZ03964.1| Ycf3 [Ranunculus macranthus] Length = 170 Score = 90.5 bits (223), Expect = 5e-16 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGAI 691 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGAI Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGAI 44 >gb|AGJ51257.1| photosystem I assembly protein Ycf3 (chloroplast) [Solanum carolinense] Length = 44 Score = 90.1 bits (222), Expect = 7e-16 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGAI 691 MPRSRINGNFIDKTFSIVANILLR+IPTTSGEKEAFTYYRDGAI Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRVIPTTSGEKEAFTYYRDGAI 44 >ref|YP_008963481.1| hypothetical chloroplast RF34 (chloroplast) [Penthorum chinense] gi|403226782|gb|AFR25661.1| hypothetical chloroplast RF34 (chloroplast) [Penthorum chinense] Length = 169 Score = 89.4 bits (220), Expect = 1e-15 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGAI 691 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGA+ Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGAM 44 >ref|YP_005089148.1| ycf3 gene product [Rhynchoryza subulata] gi|346228473|gb|AEO21345.1| hypothetical chloroplast RF34 [Rhynchoryza subulata] gi|353685054|gb|AER12819.1| hypothetical chloroplast RF34 (chloroplast) [Oryza sativa Indica Group] gi|353685142|gb|AER12906.1| hypothetical chloroplast RF34 (chloroplast) [Oryza sativa Indica Group] gi|555945989|gb|AGZ19215.1| hypothetical chloroplast RF34 (chloroplast) [Oryza rufipogon] Length = 172 Score = 88.6 bits (218), Expect = 2e-15 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGAI 691 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEK AFTYYRDGAI Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKRAFTYYRDGAI 44 >ref|YP_005088011.1| ycf3 gene product [Leersia tisserantii] gi|346228305|gb|AEO21179.1| hypothetical chloroplast RF34 [Leersia tisserantii] Length = 172 Score = 88.6 bits (218), Expect = 2e-15 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGAI 691 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEK AFTYYRDGAI Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKRAFTYYRDGAI 44 >gb|AGP50756.1| hypothetical chloroplast RF34 (chloroplast) [Hordeum vulgare subsp. vulgare] gi|521301030|gb|AGP50832.1| hypothetical chloroplast RF34 (chloroplast) [Hordeum vulgare subsp. spontaneum] gi|521301111|gb|AGP50912.1| hypothetical chloroplast RF34 (chloroplast) [Hordeum vulgare subsp. spontaneum] Length = 172 Score = 88.2 bits (217), Expect = 3e-15 Identities = 41/44 (93%), Positives = 44/44 (100%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGAI 691 MPRSR+NGNFIDKTFSI+ANILLRIIPTTSGEK+AFTYYRDGAI Sbjct: 1 MPRSRVNGNFIDKTFSIIANILLRIIPTTSGEKKAFTYYRDGAI 44 >ref|YP_008592640.1| photosystem I assembly protein ycf3 (chloroplast) [Berberis bealei] gi|536462681|gb|AGU37046.1| photosystem I assembly protein ycf3 (chloroplast) [Berberis bealei] Length = 169 Score = 87.8 bits (216), Expect = 3e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGAI 691 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG + Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGVM 44 >gb|AFB70727.1| photosystem I assembly protein Ycf3, partial (chloroplast) [Mollugo verticillata] Length = 217 Score = 87.8 bits (216), Expect = 3e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGAI 691 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG + Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGVM 44 >gb|ADD30856.1| putative RF3 protein [Dillenia indica] Length = 168 Score = 87.8 bits (216), Expect = 3e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGAI 691 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG + Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGML 44 >gb|AGU00059.1| hypothetical chloroplast RF34 (chloroplast) [Glycyrrhiza glabra] Length = 168 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 685 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42 >ref|YP_008999936.1| hypothetical chloroplast RF34 (chloroplast) [Agrostemma githago] gi|576312302|ref|YP_009000186.1| hypothetical chloroplast RF34 (chloroplast) [Silene paradoxa] gi|555944022|gb|AGZ17926.1| hypothetical chloroplast RF34 (chloroplast) [Agrostemma githago] gi|555944275|gb|AGZ18176.1| hypothetical chloroplast RF34 (chloroplast) [Silene paradoxa] Length = 168 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 685 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42 >ref|YP_008993263.1| hypothetical chloroplast RF34 (chloroplast) [Magnolia dealbata] Length = 168 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 685 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42 >ref|YP_008994480.1| hypothetical chloroplast RF34 (chloroplast) [Hypseocharis bilobata] gi|540067559|gb|AGV02910.1| hypothetical chloroplast RF34 (chloroplast) [Hypseocharis bilobata] Length = 168 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 685 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42 >gb|AFK81300.1| hypothetical chloroplast RF34 [Camellia sinensis var. assamica] Length = 168 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 685 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42 >ref|YP_008963606.1| photosystem I assembly protein Ycf3 (chloroplast) [Lupinus luteus] gi|485474317|gb|AGK82919.1| photosystem I assembly protein Ycf3 (chloroplast) [Lupinus luteus] Length = 168 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 685 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42 >ref|YP_008814857.1| hypothetical chloroplast RF21 (chloroplast) [Aralia undulata] gi|458599091|gb|AGG38957.1| hypothetical chloroplast RF21 (chloroplast) [Aralia undulata] Length = 168 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 685 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42 >gb|AGW96677.1| hypothetical chloroplast RF34 (chloroplast) [Argyreia nervosa] Length = 168 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 685 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42 >gb|AGQ50350.1| hypothetical chloroplast RF34 (chloroplast) [Rumex acetosa] Length = 169 Score = 87.4 bits (215), Expect = 4e-15 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGAI 691 MPRSRINGNFIDKTFS+VANILLRIIPTTSGEKEAFTYYRDG + Sbjct: 1 MPRSRINGNFIDKTFSVVANILLRIIPTTSGEKEAFTYYRDGVM 44 >ref|YP_008081266.1| hypothetical chloroplast RF34 (chloroplast) [Catharanthus roseus] gi|474452077|gb|AGI51145.1| hypothetical chloroplast RF34 (chloroplast) [Catharanthus roseus] Length = 168 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 685 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42 >ref|YP_007317249.1| photosystem I assembly protein Ycf3 (chloroplast) [Camellia sinensis] gi|430728273|gb|AGA55597.1| photosystem I assembly protein Ycf3 (chloroplast) [Camellia sinensis] Length = 168 Score = 87.4 bits (215), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +2 Query: 560 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 685 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42