BLASTX nr result
ID: Paeonia23_contig00020434
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00020434 (439 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300157.1| hypothetical protein POPTR_0001s32530g [Popu... 57 2e-06 ref|XP_006297761.1| hypothetical protein CARUB_v10013795mg [Caps... 56 5e-06 >ref|XP_002300157.1| hypothetical protein POPTR_0001s32530g [Populus trichocarpa] gi|222847415|gb|EEE84962.1| hypothetical protein POPTR_0001s32530g [Populus trichocarpa] Length = 429 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/61 (45%), Positives = 39/61 (63%), Gaps = 1/61 (1%) Frame = -1 Query: 436 TIRSRVTKLTDIHRSCK-DDVSELTCSDMEKIQADCVPQIQGKANQLVSEYLDFDSLGIE 260 TIRSR+ +L +I+R C D SE+ SD +++ D Q+ K +Q V+EY DF LGIE Sbjct: 16 TIRSRINELEEIYRDCNADSFSEINSSDSDELMKDSAQQLVSKVSQTVTEYSDFSFLGIE 75 Query: 259 D 257 D Sbjct: 76 D 76 >ref|XP_006297761.1| hypothetical protein CARUB_v10013795mg [Capsella rubella] gi|482566470|gb|EOA30659.1| hypothetical protein CARUB_v10013795mg [Capsella rubella] Length = 420 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/60 (46%), Positives = 37/60 (61%) Frame = -1 Query: 433 IRSRVTKLTDIHRSCKDDVSELTCSDMEKIQADCVPQIQGKANQLVSEYLDFDSLGIEDS 254 IRSRV +L IHR+CK + E SD E + D V Q + K N++V +Y D D L +EDS Sbjct: 15 IRSRVKELESIHRNCKYEPGESCTSDSENLVQDFVLQFETKVNEIVEDYSDVDILDVEDS 74