BLASTX nr result
ID: Paeonia23_contig00020130
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00020130 (250 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273398.2| PREDICTED: putative pentatricopeptide repeat... 127 2e-27 gb|EXC44867.1| hypothetical protein L484_000446 [Morus notabilis] 125 6e-27 gb|EXC19798.1| hypothetical protein L484_000854 [Morus notabilis] 125 6e-27 ref|XP_002518803.1| pentatricopeptide repeat-containing protein,... 122 7e-26 gb|ADQ43199.1| unknown [Eutrema parvulum] 119 4e-25 ref|XP_007224618.1| hypothetical protein PRUPE_ppa026847mg [Prun... 118 7e-25 ref|XP_006585057.1| PREDICTED: putative pentatricopeptide repeat... 118 1e-24 ref|XP_006585050.1| PREDICTED: putative pentatricopeptide repeat... 118 1e-24 ref|NP_178323.3| putative pentatricopeptide repeat-containing pr... 117 2e-24 gb|AAC97219.1| hypothetical protein [Arabidopsis thaliana] 117 2e-24 ref|XP_007045328.1| Pentatricopeptide repeat-containing protein,... 116 4e-24 ref|XP_002315826.2| pentatricopeptide repeat-containing family p... 115 8e-24 ref|XP_004298631.1| PREDICTED: putative pentatricopeptide repeat... 114 1e-23 ref|XP_004504624.1| PREDICTED: putative pentatricopeptide repeat... 114 1e-23 ref|XP_006395805.1| hypothetical protein EUTSA_v10003688mg [Eutr... 114 2e-23 gb|ACQ90610.1| putative PPR repeat protein [Eutrema halophilum] 114 2e-23 ref|XP_006470947.1| PREDICTED: putative pentatricopeptide repeat... 113 3e-23 ref|XP_007158843.1| hypothetical protein PHAVU_002G186700g [Phas... 113 3e-23 ref|XP_002876800.1| hypothetical protein ARALYDRAFT_484139 [Arab... 112 5e-23 ref|XP_006420675.1| hypothetical protein CICLE_v10004591mg [Citr... 111 9e-23 >ref|XP_002273398.2| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like [Vitis vinifera] Length = 755 Score = 127 bits (318), Expect = 2e-27 Identities = 58/83 (69%), Positives = 71/83 (85%) Frame = -2 Query: 249 VIKDLILRRRSLPGCDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKMRR 70 V+K+LI RR LP DVFDLLW+TR+V +PG+GVFD+LFS L+ELG+ +EA ECF KMR+ Sbjct: 154 VLKELICLRRVLPSWDVFDLLWATRNVCVPGFGVFDALFSALIELGMLEEASECFLKMRK 213 Query: 69 FRVFPKARSCNVLLHRLSKLGKG 1 FRVFPK RSCN LLHRLSK+G+G Sbjct: 214 FRVFPKPRSCNALLHRLSKVGRG 236 >gb|EXC44867.1| hypothetical protein L484_000446 [Morus notabilis] Length = 789 Score = 125 bits (314), Expect = 6e-27 Identities = 56/82 (68%), Positives = 70/82 (85%) Frame = -2 Query: 249 VIKDLILRRRSLPGCDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKMRR 70 V+++L+ R LPGCDVFD+LWSTR+V +PG+GVFD+LFSVLVELG+ +EA++CF KMR+ Sbjct: 188 VLRELVSSNRVLPGCDVFDVLWSTRNVCVPGFGVFDALFSVLVELGMLEEANQCFLKMRK 247 Query: 69 FRVFPKARSCNVLLHRLSKLGK 4 F V PK RSCN LHRLSKLGK Sbjct: 248 FHVLPKPRSCNAFLHRLSKLGK 269 >gb|EXC19798.1| hypothetical protein L484_000854 [Morus notabilis] Length = 789 Score = 125 bits (314), Expect = 6e-27 Identities = 56/82 (68%), Positives = 70/82 (85%) Frame = -2 Query: 249 VIKDLILRRRSLPGCDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKMRR 70 V+++L+ R LPGCDVFD+LWSTR+V +PG+GVFD+LFSVLVELG+ +EA++CF KMR+ Sbjct: 188 VLRELVSSNRVLPGCDVFDVLWSTRNVCVPGFGVFDALFSVLVELGMLEEANQCFLKMRK 247 Query: 69 FRVFPKARSCNVLLHRLSKLGK 4 F V PK RSCN LHRLSKLGK Sbjct: 248 FHVLPKPRSCNAFLHRLSKLGK 269 >ref|XP_002518803.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542184|gb|EEF43728.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 775 Score = 122 bits (305), Expect = 7e-26 Identities = 55/82 (67%), Positives = 70/82 (85%) Frame = -2 Query: 246 IKDLILRRRSLPGCDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKMRRF 67 +K+LI RR LPG DVF++LWSTR+V +PG+GVFD+LFSV +ELG+ +EA +CFS+M RF Sbjct: 152 LKELISSRRILPGFDVFEVLWSTRNVCVPGFGVFDALFSVFIELGMLEEAGQCFSRMTRF 211 Query: 66 RVFPKARSCNVLLHRLSKLGKG 1 RVFPKARSCN L+RL+K GKG Sbjct: 212 RVFPKARSCNAFLYRLAKTGKG 233 >gb|ADQ43199.1| unknown [Eutrema parvulum] Length = 1128 Score = 119 bits (298), Expect = 4e-25 Identities = 51/82 (62%), Positives = 70/82 (85%) Frame = -2 Query: 249 VIKDLILRRRSLPGCDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKMRR 70 ++++++L + L CDVFD LWSTR+V +PG+GVFD+LFSVL++LG+ +EA +CFSKM+R Sbjct: 32 ILREIVLSKAELEECDVFDELWSTRNVCVPGFGVFDALFSVLIDLGMLEEATQCFSKMKR 91 Query: 69 FRVFPKARSCNVLLHRLSKLGK 4 FRVFPK RSCN LLH+ +KLGK Sbjct: 92 FRVFPKTRSCNGLLHKFAKLGK 113 >ref|XP_007224618.1| hypothetical protein PRUPE_ppa026847mg [Prunus persica] gi|462421554|gb|EMJ25817.1| hypothetical protein PRUPE_ppa026847mg [Prunus persica] Length = 628 Score = 118 bits (296), Expect = 7e-25 Identities = 54/83 (65%), Positives = 68/83 (81%) Frame = -2 Query: 249 VIKDLILRRRSLPGCDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKMRR 70 ++K+L+ RR LPGCDVFD+LWSTR+V G+GVFD+LFSVLVE G+ ++A ECF +M++ Sbjct: 8 ILKELVSLRRVLPGCDVFDVLWSTRNVCRLGFGVFDALFSVLVEFGMLEKASECFLRMKK 67 Query: 69 FRVFPKARSCNVLLHRLSKLGKG 1 FRV PK RSCN LL RLSK GKG Sbjct: 68 FRVLPKVRSCNALLQRLSKPGKG 90 >ref|XP_006585057.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like isoform X8 [Glycine max] Length = 702 Score = 118 bits (295), Expect = 1e-24 Identities = 55/83 (66%), Positives = 66/83 (79%) Frame = -2 Query: 249 VIKDLILRRRSLPGCDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKMRR 70 VIK+ IL R PGCD FD+LWSTR+V PG+GVFD+LF+VLV+LG+ +EA +CF KM + Sbjct: 101 VIKEWILLGREFPGCDFFDMLWSTRNVCRPGFGVFDTLFNVLVDLGMLEEARQCFWKMNK 160 Query: 69 FRVFPKARSCNVLLHRLSKLGKG 1 FRV PK RSCN LLHRLSK KG Sbjct: 161 FRVLPKVRSCNELLHRLSKSSKG 183 >ref|XP_006585050.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like isoform X1 [Glycine max] gi|571470572|ref|XP_006585051.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like isoform X2 [Glycine max] gi|571470574|ref|XP_006585052.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like isoform X3 [Glycine max] gi|571470576|ref|XP_006585053.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like isoform X4 [Glycine max] gi|571470578|ref|XP_006585054.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like isoform X5 [Glycine max] gi|571470580|ref|XP_006585055.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like isoform X6 [Glycine max] gi|571470582|ref|XP_006585056.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like isoform X7 [Glycine max] Length = 751 Score = 118 bits (295), Expect = 1e-24 Identities = 55/83 (66%), Positives = 66/83 (79%) Frame = -2 Query: 249 VIKDLILRRRSLPGCDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKMRR 70 VIK+ IL R PGCD FD+LWSTR+V PG+GVFD+LF+VLV+LG+ +EA +CF KM + Sbjct: 150 VIKEWILLGREFPGCDFFDMLWSTRNVCRPGFGVFDTLFNVLVDLGMLEEARQCFWKMNK 209 Query: 69 FRVFPKARSCNVLLHRLSKLGKG 1 FRV PK RSCN LLHRLSK KG Sbjct: 210 FRVLPKVRSCNELLHRLSKSSKG 232 >ref|NP_178323.3| putative pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546751|sp|P0C894.1|PP143_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At2g02150 gi|330250459|gb|AEC05553.1| putative pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 761 Score = 117 bits (292), Expect = 2e-24 Identities = 53/82 (64%), Positives = 70/82 (85%) Frame = -2 Query: 249 VIKDLILRRRSLPGCDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKMRR 70 V+K+++L + CDVFD+LWSTR+V +PG+GVFD+LFSVL++LG+ +EA +CFSKM+R Sbjct: 164 VLKEMVLSKAD---CDVFDVLWSTRNVCVPGFGVFDALFSVLIDLGMLEEAIQCFSKMKR 220 Query: 69 FRVFPKARSCNVLLHRLSKLGK 4 FRVFPK RSCN LLHR +KLGK Sbjct: 221 FRVFPKTRSCNGLLHRFAKLGK 242 >gb|AAC97219.1| hypothetical protein [Arabidopsis thaliana] Length = 1107 Score = 117 bits (292), Expect = 2e-24 Identities = 53/82 (64%), Positives = 70/82 (85%) Frame = -2 Query: 249 VIKDLILRRRSLPGCDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKMRR 70 V+K+++L + CDVFD+LWSTR+V +PG+GVFD+LFSVL++LG+ +EA +CFSKM+R Sbjct: 32 VLKEMVLSKAD---CDVFDVLWSTRNVCVPGFGVFDALFSVLIDLGMLEEAIQCFSKMKR 88 Query: 69 FRVFPKARSCNVLLHRLSKLGK 4 FRVFPK RSCN LLHR +KLGK Sbjct: 89 FRVFPKTRSCNGLLHRFAKLGK 110 >ref|XP_007045328.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|590697040|ref|XP_007045329.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|590697044|ref|XP_007045330.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|590697048|ref|XP_007045331.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508709263|gb|EOY01160.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508709264|gb|EOY01161.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508709265|gb|EOY01162.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508709266|gb|EOY01163.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 779 Score = 116 bits (290), Expect = 4e-24 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 2/84 (2%) Frame = -2 Query: 249 VIKDLILRRRS--LPGCDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKM 76 ++K+ IL R+ LPGCD FD+LWSTR+V G+GVFD+LFSVLV+LG+ +EA +CFSKM Sbjct: 176 ILKEFILLRQRVVLPGCDFFDVLWSTRNVCRYGFGVFDALFSVLVDLGMLEEASQCFSKM 235 Query: 75 RRFRVFPKARSCNVLLHRLSKLGK 4 +R+RV PK RSCN LLHRLSK G+ Sbjct: 236 KRYRVLPKVRSCNALLHRLSKTGR 259 >ref|XP_002315826.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550329538|gb|EEF01997.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 620 Score = 115 bits (287), Expect = 8e-24 Identities = 51/83 (61%), Positives = 68/83 (81%) Frame = -2 Query: 249 VIKDLILRRRSLPGCDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKMRR 70 ++K+L+L LPG DVF++LW+TR+V +PG+GVFD+LFSVLVELG+ + A +CF +M + Sbjct: 8 ILKELVLSSWVLPGSDVFEILWTTRNVCVPGFGVFDALFSVLVELGMLEAAGQCFLRMTK 67 Query: 69 FRVFPKARSCNVLLHRLSKLGKG 1 FRV PKARSCN LHRLSK G+G Sbjct: 68 FRVLPKARSCNAFLHRLSKAGEG 90 >ref|XP_004298631.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like [Fragaria vesca subsp. vesca] Length = 760 Score = 114 bits (286), Expect = 1e-23 Identities = 54/82 (65%), Positives = 66/82 (80%) Frame = -2 Query: 246 IKDLILRRRSLPGCDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKMRRF 67 I++L+L R LPG DVFD LW TR+V PG+GVFD+LFSVLVELG+ ++A+ECF +MR+ Sbjct: 174 IRELVLLSRGLPGFDVFDGLWETRNVCRPGFGVFDALFSVLVELGMLEKANECFLRMRKC 233 Query: 66 RVFPKARSCNVLLHRLSKLGKG 1 RV PK RSCN LLH LSK GKG Sbjct: 234 RVLPKVRSCNALLHGLSKSGKG 255 >ref|XP_004504624.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like isoform X1 [Cicer arietinum] gi|502141760|ref|XP_004504625.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like isoform X2 [Cicer arietinum] gi|502141762|ref|XP_004504626.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like isoform X3 [Cicer arietinum] Length = 745 Score = 114 bits (285), Expect = 1e-23 Identities = 53/83 (63%), Positives = 66/83 (79%) Frame = -2 Query: 249 VIKDLILRRRSLPGCDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKMRR 70 VIK+ IL RR +PGCD FD+LW TR+V G+GVFD+LF VLVELG+ E+ +CF KM++ Sbjct: 150 VIKEWILLRREIPGCDWFDMLWLTRNVCRTGFGVFDALFGVLVELGMLDESRQCFWKMKK 209 Query: 69 FRVFPKARSCNVLLHRLSKLGKG 1 FRV PK RSCNVLLH+LSK +G Sbjct: 210 FRVLPKVRSCNVLLHKLSKSDQG 232 >ref|XP_006395805.1| hypothetical protein EUTSA_v10003688mg [Eutrema salsugineum] gi|557092444|gb|ESQ33091.1| hypothetical protein EUTSA_v10003688mg [Eutrema salsugineum] Length = 762 Score = 114 bits (284), Expect = 2e-23 Identities = 49/82 (59%), Positives = 69/82 (84%) Frame = -2 Query: 249 VIKDLILRRRSLPGCDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKMRR 70 ++++++L + L CDVFD+LWSTR+V +PG+GVFD+LFSVL+E +F+EA +CFSKM+R Sbjct: 162 ILREMVLSKAELKDCDVFDVLWSTRNVCVPGFGVFDALFSVLIEEDMFEEALQCFSKMKR 221 Query: 69 FRVFPKARSCNVLLHRLSKLGK 4 RVFPK RSCN LLH+ ++LGK Sbjct: 222 CRVFPKTRSCNGLLHKFARLGK 243 >gb|ACQ90610.1| putative PPR repeat protein [Eutrema halophilum] Length = 1023 Score = 114 bits (284), Expect = 2e-23 Identities = 49/82 (59%), Positives = 69/82 (84%) Frame = -2 Query: 249 VIKDLILRRRSLPGCDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKMRR 70 ++++++L + L CDVFD+LWSTR+V +PG+GVFD+LFSVL+E +F+EA +CFSKM+R Sbjct: 32 ILREMVLSKAELKDCDVFDVLWSTRNVCVPGFGVFDALFSVLIEEDMFEEALQCFSKMKR 91 Query: 69 FRVFPKARSCNVLLHRLSKLGK 4 RVFPK RSCN LLH+ ++LGK Sbjct: 92 CRVFPKTRSCNGLLHKFARLGK 113 >ref|XP_006470947.1| PREDICTED: putative pentatricopeptide repeat-containing protein At2g02150-like [Citrus sinensis] Length = 1236 Score = 113 bits (282), Expect = 3e-23 Identities = 56/84 (66%), Positives = 68/84 (80%), Gaps = 2/84 (2%) Frame = -2 Query: 246 IKDLIL--RRRSLPGCDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKMR 73 +K+LIL R R LPG D FD LWSTR+V + GVFD+LFS LV+LG+ +EA++CFS+M+ Sbjct: 168 LKELILSIRSRKLPGFDAFDALWSTRNVCVFASGVFDALFSNLVDLGMLEEANDCFSRMK 227 Query: 72 RFRVFPKARSCNVLLHRLSKLGKG 1 RFRV PKARSCN LLHRLSK GKG Sbjct: 228 RFRVLPKARSCNALLHRLSKSGKG 251 >ref|XP_007158843.1| hypothetical protein PHAVU_002G186700g [Phaseolus vulgaris] gi|561032258|gb|ESW30837.1| hypothetical protein PHAVU_002G186700g [Phaseolus vulgaris] Length = 751 Score = 113 bits (282), Expect = 3e-23 Identities = 54/83 (65%), Positives = 64/83 (77%) Frame = -2 Query: 249 VIKDLILRRRSLPGCDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKMRR 70 VI++ IL R PG D FD+LWSTR+V PG+GVFD+LFSVLV+LG+ EA +CF KM + Sbjct: 150 VIREWILLGREFPGVDFFDMLWSTRNVCRPGFGVFDTLFSVLVDLGMLDEARQCFWKMNK 209 Query: 69 FRVFPKARSCNVLLHRLSKLGKG 1 FRV PK RSCN LLHRLSK KG Sbjct: 210 FRVLPKVRSCNELLHRLSKSDKG 232 >ref|XP_002876800.1| hypothetical protein ARALYDRAFT_484139 [Arabidopsis lyrata subsp. lyrata] gi|297322638|gb|EFH53059.1| hypothetical protein ARALYDRAFT_484139 [Arabidopsis lyrata subsp. lyrata] Length = 1010 Score = 112 bits (280), Expect = 5e-23 Identities = 49/68 (72%), Positives = 62/68 (91%) Frame = -2 Query: 207 CDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKMRRFRVFPKARSCNVLL 28 CDVFD+LWSTR+V +PG+GVFD+LFSVL++LG+ +EA +CFSKM+RFRVFPK RSCN LL Sbjct: 8 CDVFDVLWSTRNVCVPGFGVFDALFSVLIDLGMVEEAIQCFSKMKRFRVFPKTRSCNGLL 67 Query: 27 HRLSKLGK 4 H+ +KLGK Sbjct: 68 HKFAKLGK 75 >ref|XP_006420675.1| hypothetical protein CICLE_v10004591mg [Citrus clementina] gi|557522548|gb|ESR33915.1| hypothetical protein CICLE_v10004591mg [Citrus clementina] Length = 599 Score = 111 bits (278), Expect = 9e-23 Identities = 56/84 (66%), Positives = 67/84 (79%), Gaps = 2/84 (2%) Frame = -2 Query: 246 IKDLIL--RRRSLPGCDVFDLLWSTRSVFLPGYGVFDSLFSVLVELGLFKEADECFSKMR 73 +K+LIL R R LPG D FD LW TR+V + GVFD+LFS LV+LGL +EA++CFS+M+ Sbjct: 9 LKELILSIRSRKLPGFDAFDALWLTRNVCVFASGVFDALFSNLVDLGLLEEANDCFSRMK 68 Query: 72 RFRVFPKARSCNVLLHRLSKLGKG 1 RFRV PKARSCN LLHRLSK GKG Sbjct: 69 RFRVLPKARSCNALLHRLSKSGKG 92