BLASTX nr result
ID: Paeonia23_contig00020104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00020104 (270 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007024437.1| Ubiquitin-specific protease 6 [Theobroma cac... 59 7e-07 >ref|XP_007024437.1| Ubiquitin-specific protease 6 [Theobroma cacao] gi|508779803|gb|EOY27059.1| Ubiquitin-specific protease 6 [Theobroma cacao] Length = 483 Score = 58.9 bits (141), Expect = 7e-07 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 4/76 (5%) Frame = -2 Query: 245 KKAKKPSGLKDLDVKMSDVEEESSDASGDSCTTTCEEGVVCEQERQLTGVYHLVAFLVR- 69 K +K SG KD DVKM+D E SS+ASG+S TT +EGV+ ++E LTG+Y LVA L Sbjct: 365 KANEKSSGTKDDDVKMTDAEG-SSNASGESSATTPQEGVLSDKESCLTGIYDLVAVLTHK 423 Query: 68 ---SNGGNYSAFKERK 30 ++ G+Y A+ +++ Sbjct: 424 GRSADSGHYVAWVKQE 439