BLASTX nr result
ID: Paeonia23_contig00020083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00020083 (219 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006385572.1| hypothetical protein POPTR_0003s08200g [Popu... 64 3e-08 ref|XP_007039671.1| Cationic amino acid transporter, putative [T... 64 3e-08 ref|XP_004300325.1| PREDICTED: cationic amino acid transporter 6... 63 4e-08 ref|XP_006838495.1| hypothetical protein AMTR_s00002p00166780 [A... 61 1e-07 ref|XP_007156591.1| hypothetical protein PHAVU_002G001800g [Phas... 61 2e-07 ref|XP_002531231.1| cationic amino acid transporter, putative [R... 60 3e-07 ref|XP_006359260.1| PREDICTED: cationic amino acid transporter 6... 60 4e-07 ref|XP_004246169.1| PREDICTED: LOW QUALITY PROTEIN: cationic ami... 60 4e-07 ref|XP_007210584.1| hypothetical protein PRUPE_ppa015187mg [Prun... 59 5e-07 ref|XP_006283404.1| hypothetical protein CARUB_v10004452mg [Caps... 59 7e-07 ref|XP_003635611.1| PREDICTED: high affinity cationic amino acid... 59 7e-07 emb|CBI14847.3| unnamed protein product [Vitis vinifera] 59 7e-07 emb|CAN83060.1| hypothetical protein VITISV_010305 [Vitis vinifera] 59 7e-07 ref|XP_006477566.1| PREDICTED: cationic amino acid transporter 6... 59 9e-07 ref|XP_006440163.1| hypothetical protein CICLE_v10019477mg [Citr... 59 9e-07 ref|XP_006368941.1| hypothetical protein POPTR_0001s150801g, par... 57 2e-06 ref|XP_006385370.1| hypothetical protein POPTR_0003s031602g, par... 57 2e-06 ref|XP_004162422.1| PREDICTED: cationic amino acid transporter 6... 57 2e-06 ref|XP_004148384.1| PREDICTED: cationic amino acid transporter 6... 57 2e-06 gb|AFW59040.1| hypothetical protein ZEAMMB73_148244 [Zea mays] 57 2e-06 >ref|XP_006385572.1| hypothetical protein POPTR_0003s08200g [Populus trichocarpa] gi|550342699|gb|ERP63369.1| hypothetical protein POPTR_0003s08200g [Populus trichocarpa] Length = 573 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/55 (60%), Positives = 36/55 (65%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG VAH +GP SALLSSLCYTEFS++I V GG FSYLRVTF Sbjct: 75 FVTTGLVAHQISGPSVFISYIIAGISALLSSLCYTEFSVQIPVAGGAFSYLRVTF 129 >ref|XP_007039671.1| Cationic amino acid transporter, putative [Theobroma cacao] gi|508776916|gb|EOY24172.1| Cationic amino acid transporter, putative [Theobroma cacao] Length = 603 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/55 (60%), Positives = 37/55 (67%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG+VA N +GP SALLSSLCYTEFS++I V GG FSYLRVTF Sbjct: 104 FVTTGHVARNNSGPSVFISYIIAGISALLSSLCYTEFSVQIPVAGGAFSYLRVTF 158 >ref|XP_004300325.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 583 Score = 63.2 bits (152), Expect = 4e-08 Identities = 33/55 (60%), Positives = 35/55 (63%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG VAH GP SALLSSLCYTEFS++I V GG FSYLRVTF Sbjct: 83 FVTTGSVAHKTAGPSVFISYIIAGISALLSSLCYTEFSVQIPVAGGAFSYLRVTF 137 >ref|XP_006838495.1| hypothetical protein AMTR_s00002p00166780 [Amborella trichopoda] gi|548841001|gb|ERN01064.1| hypothetical protein AMTR_s00002p00166780 [Amborella trichopoda] Length = 575 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/55 (56%), Positives = 36/55 (65%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG VA N +GP +ALLSSLCYTEFS+E+ V GG FSYLR+TF Sbjct: 73 FVTTGTVALNVSGPSIFISYMVAGIAALLSSLCYTEFSVEMPVAGGAFSYLRITF 127 >ref|XP_007156591.1| hypothetical protein PHAVU_002G001800g [Phaseolus vulgaris] gi|561030006|gb|ESW28585.1| hypothetical protein PHAVU_002G001800g [Phaseolus vulgaris] Length = 577 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/55 (54%), Positives = 37/55 (67%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG VAH+ +GP SALLSSLCYTEF++++ V GG FSYLR+TF Sbjct: 74 FVTTGSVAHHQSGPSVFISYIIAGLSALLSSLCYTEFAVQVPVAGGAFSYLRLTF 128 >ref|XP_002531231.1| cationic amino acid transporter, putative [Ricinus communis] gi|223529191|gb|EEF31167.1| cationic amino acid transporter, putative [Ricinus communis] Length = 584 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/55 (60%), Positives = 35/55 (63%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG VA TGP SALLSSLCYTEFS++I V GG FSYLRVTF Sbjct: 84 FVTTGSVALEDTGPAVFISYIIAGISALLSSLCYTEFSVQIPVAGGAFSYLRVTF 138 >ref|XP_006359260.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like [Solanum tuberosum] Length = 570 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/55 (56%), Positives = 35/55 (63%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG VA +GP SALLSSLCYTEFS+++ V GG FSYLRVTF Sbjct: 65 FVTTGPVARKTSGPSVFISYIIAAVSALLSSLCYTEFSVDVPVAGGAFSYLRVTF 119 >ref|XP_004246169.1| PREDICTED: LOW QUALITY PROTEIN: cationic amino acid transporter 6, chloroplastic-like [Solanum lycopersicum] Length = 571 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/55 (56%), Positives = 35/55 (63%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG VA +GP SALLSSLCYTEFS+++ V GG FSYLRVTF Sbjct: 65 FVTTGPVARKTSGPSVFISYIVAALSALLSSLCYTEFSVDVPVAGGAFSYLRVTF 119 >ref|XP_007210584.1| hypothetical protein PRUPE_ppa015187mg [Prunus persica] gi|462406319|gb|EMJ11783.1| hypothetical protein PRUPE_ppa015187mg [Prunus persica] Length = 580 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/55 (56%), Positives = 35/55 (63%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG VA +GP SALLSSLCYTEFS++I V GG FSYLR+TF Sbjct: 80 FVTTGQVAFETSGPSVFISYIIAGISALLSSLCYTEFSVQIPVAGGAFSYLRLTF 134 >ref|XP_006283404.1| hypothetical protein CARUB_v10004452mg [Capsella rubella] gi|482552109|gb|EOA16302.1| hypothetical protein CARUB_v10004452mg [Capsella rubella] Length = 580 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/55 (56%), Positives = 35/55 (63%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG VA + +GP SALLSSLCYTEFS+ + V GG FSYLRVTF Sbjct: 63 FVTTGPVARDISGPAVFISYMVAGFSALLSSLCYTEFSVNVPVAGGAFSYLRVTF 117 >ref|XP_003635611.1| PREDICTED: high affinity cationic amino acid transporter 1-like, partial [Vitis vinifera] Length = 255 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/55 (58%), Positives = 36/55 (65%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG VA + +GP SALLSS+CYTEFS+EI V GG FSYLRVTF Sbjct: 75 FVTTGPVALHHSGPSVFISYIIAGISALLSSMCYTEFSVEIPVAGGAFSYLRVTF 129 >emb|CBI14847.3| unnamed protein product [Vitis vinifera] Length = 223 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/55 (58%), Positives = 36/55 (65%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG VA + +GP SALLSS+CYTEFS+EI V GG FSYLRVTF Sbjct: 75 FVTTGPVALHHSGPSVFISYIIAGISALLSSMCYTEFSVEIPVAGGAFSYLRVTF 129 >emb|CAN83060.1| hypothetical protein VITISV_010305 [Vitis vinifera] Length = 591 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/55 (58%), Positives = 36/55 (65%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG VA + +GP SALLSS+CYTEFS+EI V GG FSYLRVTF Sbjct: 75 FVTTGPVALHHSGPSVFISYIIAGISALLSSMCYTEFSVEIPVAGGAFSYLRVTF 129 >ref|XP_006477566.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like [Citrus sinensis] Length = 576 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/55 (58%), Positives = 35/55 (63%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG VA +GP SALLSSLCYTEFS++I V GG FSYLRVTF Sbjct: 78 FVTTGPVALQISGPSVFISYIIAGISALLSSLCYTEFSVQIPVAGGAFSYLRVTF 132 >ref|XP_006440163.1| hypothetical protein CICLE_v10019477mg [Citrus clementina] gi|557542425|gb|ESR53403.1| hypothetical protein CICLE_v10019477mg [Citrus clementina] Length = 576 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/55 (58%), Positives = 35/55 (63%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG VA +GP SALLSSLCYTEFS++I V GG FSYLRVTF Sbjct: 78 FVTTGPVALQISGPSVFISYIIAGISALLSSLCYTEFSVQIPVAGGAFSYLRVTF 132 >ref|XP_006368941.1| hypothetical protein POPTR_0001s150801g, partial [Populus trichocarpa] gi|550347300|gb|ERP65510.1| hypothetical protein POPTR_0001s150801g, partial [Populus trichocarpa] Length = 201 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/55 (56%), Positives = 34/55 (61%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG VA +GP SAL SSLCYTEFS++I V GG FSYLRVTF Sbjct: 75 FVTTGPVALKTSGPSVFISYIIAGISALFSSLCYTEFSVQIPVAGGAFSYLRVTF 129 >ref|XP_006385370.1| hypothetical protein POPTR_0003s031602g, partial [Populus trichocarpa] gi|550342312|gb|ERP63167.1| hypothetical protein POPTR_0003s031602g, partial [Populus trichocarpa] Length = 129 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/55 (56%), Positives = 34/55 (61%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG VA +GP SAL SSLCYTEFS++I V GG FSYLRVTF Sbjct: 75 FVTTGPVALKTSGPSVFISYIIAGISALFSSLCYTEFSVQIPVAGGAFSYLRVTF 129 >ref|XP_004162422.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like [Cucumis sativus] Length = 586 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/55 (54%), Positives = 34/55 (61%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG VA + TGP SALLSSLCYTEFS+ + GG FSYLR+TF Sbjct: 72 FVTTGPVALHVTGPAVFLSYIIAGISALLSSLCYTEFSVHVSAAGGAFSYLRLTF 126 >ref|XP_004148384.1| PREDICTED: cationic amino acid transporter 6, chloroplastic-like [Cucumis sativus] Length = 570 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/55 (54%), Positives = 34/55 (61%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG VA + TGP SALLSSLCYTEFS+ + GG FSYLR+TF Sbjct: 72 FVTTGPVALHVTGPAVFLSYIIAGISALLSSLCYTEFSVHVSAAGGAFSYLRLTF 126 >gb|AFW59040.1| hypothetical protein ZEAMMB73_148244 [Zea mays] Length = 566 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/55 (54%), Positives = 33/55 (60%) Frame = -3 Query: 166 FSITGYVAHNATGPXXXXXXXXXXXSALLSSLCYTEFSIEILVVGGVFSYLRVTF 2 F TG VA + GP SALLSSLCY EFS+ + V GG FSYLRVTF Sbjct: 65 FVTTGRVARDTAGPAVFASYVVAGVSALLSSLCYAEFSVRVPVAGGAFSYLRVTF 119