BLASTX nr result
ID: Paeonia23_contig00019927
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00019927 (205 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006442493.1| hypothetical protein CICLE_v10021305mg [Citr... 62 1e-07 >ref|XP_006442493.1| hypothetical protein CICLE_v10021305mg [Citrus clementina] gi|557544755|gb|ESR55733.1| hypothetical protein CICLE_v10021305mg [Citrus clementina] Length = 254 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 3 STDGTPAAFIVGQSSQCYYCAVTVGEDAVISAFRL 107 +TDG+ AAFIVGQSSQ Y+CAVT+GEDAVISAFRL Sbjct: 13 TTDGSAAAFIVGQSSQRYFCAVTIGEDAVISAFRL 47