BLASTX nr result
ID: Paeonia23_contig00019697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00019697 (254 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300588.2| Actin-related family protein [Populus tricho... 57 2e-06 >ref|XP_002300588.2| Actin-related family protein [Populus trichocarpa] gi|550350095|gb|EEE85393.2| Actin-related family protein [Populus trichocarpa] Length = 473 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +1 Query: 145 LWIFFLQNSHDSWDSIFFIKTHSRSGYPFR 234 LWI+FLQN HD+WDS+FF++TH RSGYP + Sbjct: 82 LWIYFLQNYHDTWDSVFFVETHLRSGYPIQ 111