BLASTX nr result
ID: Paeonia23_contig00019689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00019689 (290 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004289937.1| PREDICTED: chromatin modification-related pr... 64 2e-08 ref|XP_007200424.1| hypothetical protein PRUPE_ppa012749mg [Prun... 63 4e-08 ref|XP_007200423.1| hypothetical protein PRUPE_ppa012749mg [Prun... 63 4e-08 ref|XP_004148955.1| PREDICTED: chromatin modification-related pr... 59 5e-07 gb|EXC31952.1| hypothetical protein L484_009802 [Morus notabilis] 55 8e-06 >ref|XP_004289937.1| PREDICTED: chromatin modification-related protein MEAF6-like [Fragaria vesca subsp. vesca] Length = 154 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 3 GPGRSKGGILTNGQGKPKKGRPTPRDAKRMR 95 GPGRSKGGI NGQGKPKKGRPTPRDAKR+R Sbjct: 109 GPGRSKGGIYANGQGKPKKGRPTPRDAKRIR 139 >ref|XP_007200424.1| hypothetical protein PRUPE_ppa012749mg [Prunus persica] gi|462395824|gb|EMJ01623.1| hypothetical protein PRUPE_ppa012749mg [Prunus persica] Length = 156 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 3 GPGRSKGGILTNGQGKPKKGRPTPRDAKRMRP 98 GPGRSKGGI NGQGKPKKGRP PRD KR+RP Sbjct: 109 GPGRSKGGIYANGQGKPKKGRPAPRDVKRIRP 140 >ref|XP_007200423.1| hypothetical protein PRUPE_ppa012749mg [Prunus persica] gi|462395823|gb|EMJ01622.1| hypothetical protein PRUPE_ppa012749mg [Prunus persica] Length = 142 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 3 GPGRSKGGILTNGQGKPKKGRPTPRDAKRMRP 98 GPGRSKGGI NGQGKPKKGRP PRD KR+RP Sbjct: 95 GPGRSKGGIYANGQGKPKKGRPAPRDVKRIRP 126 >ref|XP_004148955.1| PREDICTED: chromatin modification-related protein MEAF6-like [Cucumis sativus] Length = 118 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/32 (87%), Positives = 29/32 (90%), Gaps = 1/32 (3%) Frame = +3 Query: 3 GPGRSKGG-ILTNGQGKPKKGRPTPRDAKRMR 95 GPGRSKGG I +NGQGKPKKGRP PRDAKRMR Sbjct: 70 GPGRSKGGAIYSNGQGKPKKGRPAPRDAKRMR 101 >gb|EXC31952.1| hypothetical protein L484_009802 [Morus notabilis] Length = 230 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/33 (78%), Positives = 27/33 (81%), Gaps = 1/33 (3%) Frame = +3 Query: 3 GPGRSKGG-ILTNGQGKPKKGRPTPRDAKRMRP 98 G GR KGG I NGQGKPKKGRPTPRD KR+RP Sbjct: 183 GSGRPKGGGIYANGQGKPKKGRPTPRDTKRIRP 215