BLASTX nr result
ID: Paeonia23_contig00019634
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00019634 (247 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK43632.1| unknown [Medicago truncatula] 160 2e-37 sp|B7FM45.1|LIAS_MEDTR RecName: Full=Lipoyl synthase, mitochondr... 160 2e-37 gb|AFK48146.1| unknown [Medicago truncatula] 158 6e-37 ref|XP_004487312.1| PREDICTED: lipoyl synthase 2, mitochondrial-... 158 8e-37 sp|A2XU53.2|LIAS_ORYSI RecName: Full=Lipoyl synthase, mitochondr... 158 8e-37 gb|EAY94363.1| hypothetical protein OsI_16128 [Oryza sativa Indi... 158 8e-37 emb|CAH67016.1| H0523F07.4 [Oryza sativa Indica Group] 158 8e-37 sp|Q3LSN4.1|LIAS1_PEA RecName: Full=Lipoyl synthase 1, mitochond... 157 1e-36 gb|EXB62277.1| Lipoyl synthase [Morus notabilis] 156 2e-36 emb|CBI38451.3| unnamed protein product [Vitis vinifera] 156 2e-36 ref|XP_002266132.2| PREDICTED: LOW QUALITY PROTEIN: lipoyl synth... 156 2e-36 ref|XP_006653475.1| PREDICTED: lipoyl synthase, mitochondrial-li... 156 3e-36 sp|Q3LSN5.1|LIAS2_PEA RecName: Full=Lipoyl synthase 2, mitochond... 155 4e-36 ref|NP_001052964.1| Os04g0455800 [Oryza sativa Japonica Group] g... 155 4e-36 ref|XP_007215533.1| hypothetical protein PRUPE_ppa007143mg [Prun... 155 5e-36 ref|XP_006447321.1| hypothetical protein CICLE_v10015632mg [Citr... 155 7e-36 ref|XP_006447320.1| hypothetical protein CICLE_v10015632mg [Citr... 155 7e-36 ref|XP_007043522.1| Lipoyl synthase, mitochondrial isoform 1 [Th... 154 1e-35 ref|XP_003543350.1| PREDICTED: lipoyl synthase 2, mitochondrial ... 154 1e-35 ref|XP_004975823.1| PREDICTED: lipoyl synthase, mitochondrial-li... 153 3e-35 >gb|AFK43632.1| unknown [Medicago truncatula] Length = 378 Score = 160 bits (405), Expect = 2e-37 Identities = 75/82 (91%), Positives = 81/82 (98%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 +VL++AKDYAPAGTLTKTSIMLGCGETPDQ++ TMEKVRAAGVDVMTFGQYMRPSKRHMP Sbjct: 263 DVLRMAKDYAPAGTLTKTSIMLGCGETPDQIVKTMEKVRAAGVDVMTFGQYMRPSKRHMP 322 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEYITPEAFEKYQTLGM+MGF Sbjct: 323 VSEYITPEAFEKYQTLGMEMGF 344 >sp|B7FM45.1|LIAS_MEDTR RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic acid synthase; Flags: Precursor gi|217074936|gb|ACJ85828.1| unknown [Medicago truncatula] Length = 378 Score = 160 bits (405), Expect = 2e-37 Identities = 75/82 (91%), Positives = 81/82 (98%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 +VL++AKDYAPAGTLTKTSIMLGCGETPDQ++ TMEKVRAAGVDVMTFGQYMRPSKRHMP Sbjct: 263 DVLRMAKDYAPAGTLTKTSIMLGCGETPDQIVKTMEKVRAAGVDVMTFGQYMRPSKRHMP 322 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEYITPEAFEKYQTLGM+MGF Sbjct: 323 VSEYITPEAFEKYQTLGMEMGF 344 >gb|AFK48146.1| unknown [Medicago truncatula] Length = 378 Score = 158 bits (400), Expect = 6e-37 Identities = 74/82 (90%), Positives = 80/82 (97%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 +VL++AKDYAPAGTLTKTSIMLGCGETPDQ++ TMEKVRAAGVDVMTFGQYMRPSKRHMP Sbjct: 263 DVLRMAKDYAPAGTLTKTSIMLGCGETPDQIVKTMEKVRAAGVDVMTFGQYMRPSKRHMP 322 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEYITPEAFEKYQ LGM+MGF Sbjct: 323 VSEYITPEAFEKYQALGMEMGF 344 >ref|XP_004487312.1| PREDICTED: lipoyl synthase 2, mitochondrial-like [Cicer arietinum] Length = 380 Score = 158 bits (399), Expect = 8e-37 Identities = 75/82 (91%), Positives = 80/82 (97%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 +VL +AK+YAPAGTLTKTSIMLGCGETPDQV+ TMEKVRAAGVDVMTFGQYMRPSKRHMP Sbjct: 261 DVLMMAKEYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMP 320 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEYITPEAFEKYQTLGM+MGF Sbjct: 321 VSEYITPEAFEKYQTLGMEMGF 342 >sp|A2XU53.2|LIAS_ORYSI RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic acid synthase; Flags: Precursor Length = 382 Score = 158 bits (399), Expect = 8e-37 Identities = 74/82 (90%), Positives = 82/82 (100%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 +VLKLAK+YAPAGTLTKTSIMLGCGETPDQV+STMEKVRAAGVDVMTFGQYMRPSKRHMP Sbjct: 266 DVLKLAKEYAPAGTLTKTSIMLGCGETPDQVISTMEKVRAAGVDVMTFGQYMRPSKRHMP 325 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEY+TPEAFE+Y++LG+DMGF Sbjct: 326 VSEYVTPEAFERYRSLGVDMGF 347 >gb|EAY94363.1| hypothetical protein OsI_16128 [Oryza sativa Indica Group] Length = 360 Score = 158 bits (399), Expect = 8e-37 Identities = 74/82 (90%), Positives = 82/82 (100%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 +VLKLAK+YAPAGTLTKTSIMLGCGETPDQV+STMEKVRAAGVDVMTFGQYMRPSKRHMP Sbjct: 266 DVLKLAKEYAPAGTLTKTSIMLGCGETPDQVISTMEKVRAAGVDVMTFGQYMRPSKRHMP 325 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEY+TPEAFE+Y++LG+DMGF Sbjct: 326 VSEYVTPEAFERYRSLGVDMGF 347 >emb|CAH67016.1| H0523F07.4 [Oryza sativa Indica Group] Length = 382 Score = 158 bits (399), Expect = 8e-37 Identities = 74/82 (90%), Positives = 82/82 (100%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 +VLKLAK+YAPAGTLTKTSIMLGCGETPDQV+STMEKVRAAGVDVMTFGQYMRPSKRHMP Sbjct: 266 DVLKLAKEYAPAGTLTKTSIMLGCGETPDQVISTMEKVRAAGVDVMTFGQYMRPSKRHMP 325 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEY+TPEAFE+Y++LG+DMGF Sbjct: 326 VSEYVTPEAFERYRSLGVDMGF 347 >sp|Q3LSN4.1|LIAS1_PEA RecName: Full=Lipoyl synthase 1, mitochondrial; AltName: Full=Lipoate synthase 1; Short=LS 1; Short=Lip-syn 1; AltName: Full=Lipoic acid synthase 1; Flags: Precursor gi|75860378|gb|ABA29156.1| putative lipoic acid synthase [Pisum sativum] Length = 376 Score = 157 bits (398), Expect = 1e-36 Identities = 74/82 (90%), Positives = 80/82 (97%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 +VL +AK+YAPAGTLTKTSIMLGCGETPDQ++ TMEKVRAAGVDVMTFGQYMRPSKRHMP Sbjct: 263 DVLMMAKEYAPAGTLTKTSIMLGCGETPDQIVKTMEKVRAAGVDVMTFGQYMRPSKRHMP 322 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEYITPEAFEKYQTLGM+MGF Sbjct: 323 VSEYITPEAFEKYQTLGMEMGF 344 >gb|EXB62277.1| Lipoyl synthase [Morus notabilis] Length = 384 Score = 156 bits (395), Expect = 2e-36 Identities = 74/82 (90%), Positives = 79/82 (96%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 +VL +AKDYAPAGTLTKTSIMLGCGETPDQV+ TMEKVRAAGVDVMTFGQYMRPSKRHMP Sbjct: 266 DVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMP 325 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEYITPEAF+KY+ LGMDMGF Sbjct: 326 VSEYITPEAFDKYRVLGMDMGF 347 >emb|CBI38451.3| unnamed protein product [Vitis vinifera] Length = 178 Score = 156 bits (395), Expect = 2e-36 Identities = 76/82 (92%), Positives = 79/82 (96%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 EVLKLAK+YA AGTLTKTSIMLGCGETPDQV+ TMEKVRAAGVDVMTFGQYMRPSKRHMP Sbjct: 54 EVLKLAKEYADAGTLTKTSIMLGCGETPDQVVRTMEKVRAAGVDVMTFGQYMRPSKRHMP 113 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEYITPEAFEKY+ LGMDMGF Sbjct: 114 VSEYITPEAFEKYRILGMDMGF 135 >ref|XP_002266132.2| PREDICTED: LOW QUALITY PROTEIN: lipoyl synthase, mitochondrial [Vitis vinifera] gi|308191441|sp|A5CB81.1|LIAS_VITVI RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic acid synthase; Flags: Precursor gi|147825263|emb|CAN73265.1| hypothetical protein VITISV_021769 [Vitis vinifera] Length = 393 Score = 156 bits (395), Expect = 2e-36 Identities = 76/82 (92%), Positives = 79/82 (96%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 EVLKLAK+YA AGTLTKTSIMLGCGETPDQV+ TMEKVRAAGVDVMTFGQYMRPSKRHMP Sbjct: 269 EVLKLAKEYADAGTLTKTSIMLGCGETPDQVVRTMEKVRAAGVDVMTFGQYMRPSKRHMP 328 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEYITPEAFEKY+ LGMDMGF Sbjct: 329 VSEYITPEAFEKYRILGMDMGF 350 >ref|XP_006653475.1| PREDICTED: lipoyl synthase, mitochondrial-like, partial [Oryza brachyantha] Length = 319 Score = 156 bits (394), Expect = 3e-36 Identities = 73/82 (89%), Positives = 80/82 (97%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 +VLK+AK+YAPAGTLTKTSIMLGCGETPDQV+STMEKVRAAGVDVMTFGQYMRPSKRHMP Sbjct: 200 DVLKMAKEYAPAGTLTKTSIMLGCGETPDQVISTMEKVRAAGVDVMTFGQYMRPSKRHMP 259 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEY+TPEAFE Y+ LG+DMGF Sbjct: 260 VSEYVTPEAFESYRALGVDMGF 281 >sp|Q3LSN5.1|LIAS2_PEA RecName: Full=Lipoyl synthase 2, mitochondrial; AltName: Full=Lipoate synthase 2; Short=LS 2; Short=Lip-syn 2; AltName: Full=Lipoic acid synthase 2; Flags: Precursor gi|75860376|gb|ABA29155.1| putative lipoic acid synthase [Pisum sativum] Length = 376 Score = 155 bits (393), Expect = 4e-36 Identities = 73/82 (89%), Positives = 80/82 (97%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 +VL +AK+YAPAGTLTKTSIMLGCGETPDQ++ TMEKVRAAGVDVMTFGQ+MRPSKRHMP Sbjct: 263 DVLMMAKEYAPAGTLTKTSIMLGCGETPDQIVKTMEKVRAAGVDVMTFGQHMRPSKRHMP 322 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEYITPEAFEKYQTLGM+MGF Sbjct: 323 VSEYITPEAFEKYQTLGMEMGF 344 >ref|NP_001052964.1| Os04g0455800 [Oryza sativa Japonica Group] gi|75144105|sp|Q7XRF1.2|LIAS_ORYSJ RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic acid synthase; Flags: Precursor gi|38347101|emb|CAE02573.2| OSJNBa0006M15.16 [Oryza sativa Japonica Group] gi|113564535|dbj|BAF14878.1| Os04g0455800 [Oryza sativa Japonica Group] gi|125590593|gb|EAZ30943.1| hypothetical protein OsJ_15022 [Oryza sativa Japonica Group] gi|215767881|dbj|BAH00110.1| unnamed protein product [Oryza sativa Japonica Group] Length = 382 Score = 155 bits (393), Expect = 4e-36 Identities = 73/82 (89%), Positives = 81/82 (98%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 +VLKLAK+YAPAGTLTKTSIMLGCGETPDQV+ST EKVRAAGVDVMTFGQYMRPSKRHMP Sbjct: 266 DVLKLAKEYAPAGTLTKTSIMLGCGETPDQVISTTEKVRAAGVDVMTFGQYMRPSKRHMP 325 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEY+TPEAFE+Y++LG+DMGF Sbjct: 326 VSEYVTPEAFERYRSLGVDMGF 347 >ref|XP_007215533.1| hypothetical protein PRUPE_ppa007143mg [Prunus persica] gi|462411683|gb|EMJ16732.1| hypothetical protein PRUPE_ppa007143mg [Prunus persica] Length = 380 Score = 155 bits (392), Expect = 5e-36 Identities = 73/82 (89%), Positives = 79/82 (96%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 +VL +AKDYAPAGTLTKTS+MLGCGETPDQV+ TMEKVRAAGVDVMTFGQYMRPSKRHMP Sbjct: 262 DVLMMAKDYAPAGTLTKTSVMLGCGETPDQVVRTMEKVRAAGVDVMTFGQYMRPSKRHMP 321 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEYITPEAFEKY+ LGM+MGF Sbjct: 322 VSEYITPEAFEKYRALGMEMGF 343 >ref|XP_006447321.1| hypothetical protein CICLE_v10015632mg [Citrus clementina] gi|568877192|ref|XP_006491631.1| PREDICTED: lipoyl synthase, mitochondrial-like [Citrus sinensis] gi|557549932|gb|ESR60561.1| hypothetical protein CICLE_v10015632mg [Citrus clementina] Length = 376 Score = 155 bits (391), Expect = 7e-36 Identities = 73/82 (89%), Positives = 79/82 (96%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 +VL +AKDY PAGTLTKTSIMLGCGETPDQV+STMEKVRAAGVDVMTFGQYMRPSKRHMP Sbjct: 262 DVLMMAKDYVPAGTLTKTSIMLGCGETPDQVVSTMEKVRAAGVDVMTFGQYMRPSKRHMP 321 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEYITPEAFE+Y+ LGM+MGF Sbjct: 322 VSEYITPEAFERYRALGMEMGF 343 >ref|XP_006447320.1| hypothetical protein CICLE_v10015632mg [Citrus clementina] gi|557549931|gb|ESR60560.1| hypothetical protein CICLE_v10015632mg [Citrus clementina] Length = 363 Score = 155 bits (391), Expect = 7e-36 Identities = 73/82 (89%), Positives = 79/82 (96%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 +VL +AKDY PAGTLTKTSIMLGCGETPDQV+STMEKVRAAGVDVMTFGQYMRPSKRHMP Sbjct: 249 DVLMMAKDYVPAGTLTKTSIMLGCGETPDQVVSTMEKVRAAGVDVMTFGQYMRPSKRHMP 308 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEYITPEAFE+Y+ LGM+MGF Sbjct: 309 VSEYITPEAFERYRALGMEMGF 330 >ref|XP_007043522.1| Lipoyl synthase, mitochondrial isoform 1 [Theobroma cacao] gi|508707457|gb|EOX99353.1| Lipoyl synthase, mitochondrial isoform 1 [Theobroma cacao] Length = 376 Score = 154 bits (389), Expect = 1e-35 Identities = 74/82 (90%), Positives = 79/82 (96%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 +VL +AKD APAGTLTKTSIMLGCGETPDQV+ TMEKVRAAGVDVMTFGQYMRPSKRHMP Sbjct: 262 DVLVMAKDCAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMP 321 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEYITPEAFEKY+TLGM+MGF Sbjct: 322 VSEYITPEAFEKYRTLGMEMGF 343 >ref|XP_003543350.1| PREDICTED: lipoyl synthase 2, mitochondrial [Glycine max] Length = 378 Score = 154 bits (389), Expect = 1e-35 Identities = 72/82 (87%), Positives = 79/82 (96%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 +VL +AK+YAPAGTLTKTSIMLGCGETPDQV+ TMEKVRAAGVDVMTFGQYMRPSKRHMP Sbjct: 263 DVLMMAKEYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMP 322 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEY+TPEAF+KYQ LGM+MGF Sbjct: 323 VSEYVTPEAFDKYQKLGMEMGF 344 >ref|XP_004975823.1| PREDICTED: lipoyl synthase, mitochondrial-like [Setaria italica] Length = 385 Score = 153 bits (386), Expect = 3e-35 Identities = 71/82 (86%), Positives = 80/82 (97%) Frame = -1 Query: 247 EVLKLAKDYAPAGTLTKTSIMLGCGETPDQVMSTMEKVRAAGVDVMTFGQYMRPSKRHMP 68 +VLK+AK+YAP GTLTKTSIMLGCGETPDQV+STMEKVRAAGVDV+TFGQYMRPSKRHMP Sbjct: 266 DVLKMAKEYAPPGTLTKTSIMLGCGETPDQVISTMEKVRAAGVDVITFGQYMRPSKRHMP 325 Query: 67 VSEYITPEAFEKYQTLGMDMGF 2 VSEY+TPEAFEKY+ LG++MGF Sbjct: 326 VSEYVTPEAFEKYRALGVEMGF 347