BLASTX nr result
ID: Paeonia23_contig00018717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00018717 (320 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300101.1| Chloride channel protein CLC-a [Populus tric... 55 1e-05 >ref|XP_002300101.1| Chloride channel protein CLC-a [Populus trichocarpa] gi|222847359|gb|EEE84906.1| Chloride channel protein CLC-a [Populus trichocarpa] Length = 785 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 223 LYQPLLKKSRTLSTNSLALVGTKVSHIESLDY 318 L+QPLLK++RTLS+N LALVG KVSHIESLDY Sbjct: 31 LHQPLLKRNRTLSSNPLALVGAKVSHIESLDY 62