BLASTX nr result
ID: Paeonia23_contig00018549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00018549 (272 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB78114.1| hypothetical protein L484_004816 [Morus notabilis] 59 9e-07 >gb|EXB78114.1| hypothetical protein L484_004816 [Morus notabilis] Length = 143 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/59 (50%), Positives = 38/59 (64%) Frame = +2 Query: 2 DSWWVGRIVGRKFVEGIGQAYLVKFEITGEELYAYPSSRLRVHLDWDPLSCKWFRPRRK 178 D WWVG I G+K + Y V FE TG+E+ AYP SRLRVHLDW + KW P+++ Sbjct: 86 DGWWVGAISGKKGSDD----YFVFFETTGDEI-AYPVSRLRVHLDW--VKAKWVSPKQR 137