BLASTX nr result
ID: Paeonia23_contig00018328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00018328 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007213019.1| hypothetical protein PRUPE_ppa023041mg [Prun... 56 6e-06 >ref|XP_007213019.1| hypothetical protein PRUPE_ppa023041mg [Prunus persica] gi|462408884|gb|EMJ14218.1| hypothetical protein PRUPE_ppa023041mg [Prunus persica] Length = 453 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = +3 Query: 171 RKSSSEVLTKRLRNEMTTPMPPFKMRKEKTGDKITSLGQLV 293 +KS SE TKR RNE ++P+P FK+RKEK GD+IT+L QLV Sbjct: 319 KKSGSETATKRPRNETSSPLPAFKVRKEKMGDRITALQQLV 359