BLASTX nr result
ID: Paeonia23_contig00018047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00018047 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528871.1| conserved hypothetical protein [Ricinus comm... 71 1e-10 ref|XP_002528203.1| conserved hypothetical protein [Ricinus comm... 70 4e-10 gb|AAC17621.1| Similar to seryl-tRNA synthetase gb|U10400 from S... 69 5e-10 emb|CBI18901.3| unnamed protein product [Vitis vinifera] 57 3e-06 emb|CBI34356.3| unnamed protein product [Vitis vinifera] 56 6e-06 >ref|XP_002528871.1| conserved hypothetical protein [Ricinus communis] gi|223531670|gb|EEF33495.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 230 REPFQKFSKAQAKPRPKRGFGNSFQPAIDAPRLVPH 123 REPFQKFSKA+ KP PKRGFGNSFQPAIDAPRL PH Sbjct: 59 REPFQKFSKAKGKPGPKRGFGNSFQPAIDAPRLEPH 94 >ref|XP_002528203.1| conserved hypothetical protein [Ricinus communis] gi|223532415|gb|EEF34210.1| conserved hypothetical protein [Ricinus communis] Length = 51 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -3 Query: 230 REPFQKFSKAQAKPRPKRGFGNSFQPAIDAPRLVPH 123 +EPFQKFSKA+ PRPKRGFGNSFQPAIDAPRL PH Sbjct: 16 KEPFQKFSKAEDVPRPKRGFGNSFQPAIDAPRLEPH 51 >gb|AAC17621.1| Similar to seryl-tRNA synthetase gb|U10400 from S cerevisiae. EST gb|N96627 comes from this gene [Arabidopsis thaliana] Length = 573 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 230 REPFQKFSKAQAKPRPKRGFGNSFQPAIDAPRLVPH 123 REPFQKFSKAQ K RP+RGFGNSFQPAIDAPRL PH Sbjct: 538 REPFQKFSKAQDKLRPRRGFGNSFQPAIDAPRLRPH 573 >emb|CBI18901.3| unnamed protein product [Vitis vinifera] Length = 76 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 215 KFSKAQAKPRPKRGFGNSFQPAIDAPRLVPH 123 + + AKPRPKRGFGNSFQPAIDAPRL+PH Sbjct: 46 QMDRCAAKPRPKRGFGNSFQPAIDAPRLLPH 76 >emb|CBI34356.3| unnamed protein product [Vitis vinifera] Length = 28 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -3 Query: 203 AQAKPRPKRGFGNSFQPAIDAPRLVPH 123 A AKPRPKRGFGNSFQPAIDAPRL PH Sbjct: 2 AWAKPRPKRGFGNSFQPAIDAPRLEPH 28