BLASTX nr result
ID: Paeonia23_contig00017491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00017491 (271 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007222188.1| hypothetical protein PRUPE_ppa010039mg [Prun... 40 5e-06 gb|EXC19762.1| Chlorophyll a-b binding protein P4 [Morus notabilis] 39 5e-06 ref|XP_003603038.1| Chlorophyll a-b binding protein [Medicago tr... 41 8e-06 >ref|XP_007222188.1| hypothetical protein PRUPE_ppa010039mg [Prunus persica] gi|462419124|gb|EMJ23387.1| hypothetical protein PRUPE_ppa010039mg [Prunus persica] Length = 266 Score = 40.4 bits (93), Expect(2) = 5e-06 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -1 Query: 88 YTGSPLLNPLGLAKYAKISQKWKLKKLR 5 Y G PLLNPLGLAK K + +WKLK+++ Sbjct: 191 YPGGPLLNPLGLAKDIKNAHEWKLKEIK 218 Score = 35.4 bits (80), Expect(2) = 5e-06 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -3 Query: 269 AVKYKFANTEFLFIVQLLLMG 207 AVK+ FANTE LF+VQL+LMG Sbjct: 135 AVKFGFANTETLFLVQLILMG 155 >gb|EXC19762.1| Chlorophyll a-b binding protein P4 [Morus notabilis] Length = 264 Score = 39.3 bits (90), Expect(2) = 5e-06 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = -1 Query: 109 FISLISRYTGSPLLNPLGLAKYAKISQKWKLKKLR 5 F L Y G P+LNPLGLAK K + WKLK+++ Sbjct: 182 FEGLEPGYPGGPILNPLGLAKDIKNAHHWKLKEIK 216 Score = 36.6 bits (83), Expect(2) = 5e-06 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -3 Query: 269 AVKYKFANTEFLFIVQLLLMG 207 A+KY+FANT LFIVQLLLMG Sbjct: 134 AIKYEFANTGTLFIVQLLLMG 154 >ref|XP_003603038.1| Chlorophyll a-b binding protein [Medicago truncatula] gi|355492086|gb|AES73289.1| Chlorophyll a-b binding protein [Medicago truncatula] Length = 267 Score = 41.2 bits (95), Expect(2) = 8e-06 Identities = 17/28 (60%), Positives = 23/28 (82%) Frame = -1 Query: 88 YTGSPLLNPLGLAKYAKISQKWKLKKLR 5 Y G PLLNPLGLAK K +++WKLK+++ Sbjct: 192 YPGGPLLNPLGLAKDIKSAREWKLKEIK 219 Score = 33.9 bits (76), Expect(2) = 8e-06 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -3 Query: 269 AVKYKFANTEFLFIVQLLLMG 207 AVKY+FANT L +VQLLLMG Sbjct: 136 AVKYEFANTGTLVVVQLLLMG 156