BLASTX nr result
ID: Paeonia23_contig00017443
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00017443 (800 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_054552.1| hypothetical protein NitaCp078 [Nicotiana tabac... 115 2e-23 ref|XP_006435528.1| hypothetical protein CICLE_v10010881mg [Citr... 108 2e-21 >ref|NP_054552.1| hypothetical protein NitaCp078 [Nicotiana tabacum] gi|11466023|ref|NP_054565.1| hypothetical protein NitaCp091 [Nicotiana tabacum] gi|78102593|ref|YP_358732.1| hypothetical protein NisyCp089 [Nicotiana sylvestris] gi|78102607|ref|YP_358746.1| hypothetical protein NisyCp103 [Nicotiana sylvestris] gi|81301623|ref|YP_398918.1| hypothetical protein NitoCp088 [Nicotiana tomentosiformis] gi|81301637|ref|YP_398932.1| hypothetical protein NitoCp102 [Nicotiana tomentosiformis] gi|351653935|ref|YP_004891661.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653962|ref|YP_004891675.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|11786|emb|CAA26288.1| hypothetical protein [Nicotiana tabacum] gi|11880|emb|CAA77393.1| hypothetical protein [Nicotiana tabacum] gi|473681|gb|AAA84690.1| unknown [Nicotiana tabacum] gi|1223679|emb|CAA77400.1| hypothetical protein [Nicotiana tabacum] gi|77799620|dbj|BAE46709.1| hypothetical protein [Nicotiana sylvestris] gi|77799634|dbj|BAE46723.1| hypothetical protein [Nicotiana sylvestris] gi|80750982|dbj|BAE48058.1| hypothetical protein [Nicotiana tomentosiformis] gi|80750996|dbj|BAE48072.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453961|gb|AEO95619.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453988|gb|AEO95646.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454071|gb|AEO95728.1| hypothetical protein [synthetic construct] gi|347454097|gb|AEO95754.1| hypothetical protein [synthetic construct] gi|225251|prf||1211235CK ORF 75 Length = 75 Score = 115 bits (288), Expect = 2e-23 Identities = 64/74 (86%), Positives = 64/74 (86%) Frame = -1 Query: 545 MRHGTEPLRRSSRSCEGSFELILFMG*ERELNSMRSNLPLFLSSSAVERSAVNRLVVGSN 366 MRH EPLRRSS S EGSFELIL MG ERELNSMRSNL LFLSSS VERSAVNRLVVGSN Sbjct: 1 MRHVREPLRRSSGSYEGSFELILVMGWERELNSMRSNLLLFLSSSVVERSAVNRLVVGSN 60 Query: 365 PT*GDLIHSELKNS 324 PT GDLI SELKNS Sbjct: 61 PTWGDLIDSELKNS 74 >ref|XP_006435528.1| hypothetical protein CICLE_v10010881mg [Citrus clementina] gi|557537661|gb|ESR48768.1| hypothetical protein CICLE_v10010881mg [Citrus clementina] Length = 108 Score = 108 bits (270), Expect = 2e-21 Identities = 59/84 (70%), Positives = 65/84 (77%), Gaps = 6/84 (7%) Frame = +2 Query: 122 LLVHLRILNWLVVNSPGTVEQRIIPG---GIDGDSQISQNRM*YDEIECNRNKDREPGYL 292 +LVHLRILNWL+VNSP T+EQRIIP GIDGDSQISQNRM YDEIECNRNKD G Sbjct: 23 VLVHLRILNWLIVNSPRTMEQRIIPDLHRGIDGDSQISQNRMGYDEIECNRNKDTGNGLP 82 Query: 293 LLTVKASPF---ILNSLIQNESNL 355 ++ PF ILNSLI+NESNL Sbjct: 83 TFNGQSEPFHSDILNSLIRNESNL 106